Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1386 bp · LXL04_010284|LXL04_010284|OH1004|cDNA
ATGGGGAAAGGTACCAAATGCAAGCCTGGGTCCCACCAGATATTCAAAGACAGAGCTAAGAACCGCGTGGAGGACCTCCATGGAATGTTCACAGATCTGCAATCAGCAAGGAAGGAGAGCCGTAGCATAGATGTAGCTGTTCTCGAAGAACAAGTCAACCAGATGCTCAAAGAATGGAAGAACGAACTCAACGAACCTTCCCCCGCTTCTTCCTTACAACAGGGTGCAAGTGTGGGGCCCTTCTCTCCTGACATAAGTAA...
1386 bp · LXL04_010284|LXL04_010284|OH1004|CDS
ATGGGGAAAGGTACCAAATGCAAGCCTGGGTCCCACCAGATATTCAAAGACAGAGCTAAGAACCGCGTGGAGGACCTCCATGGAATGTTCACAGATCTGCAATCAGCAAGGAAGGAGAGCCGTAGCATAGATGTAGCTGTTCTCGAAGAACAAGTCAACCAGATGCTCAAAGAATGGAAGAACGAACTCAACGAACCTTCCCCCGCTTCTTCCTTACAACAGGGTGCAAGTGTGGGGCCCTTCTCTCCTGACATAAGTAA...
Protein
Download Protein FASTA461 aa · LXL04_010284|LXL04_010284|OH1004|PROTEIN
MGKGTKCKPGSHQIFKDRAKNRVEDLHGMFTDLQSARKESRSIDVAVLEEQVNQMLKEWKNELNEPSPASSLQQGASVGPFSPDISKLLQLCDEEDDATSVLAAPKPDPDNGQQSFPVNHTSQQQLQPFGSPSCVNNPGVTSQLDYFSFDLPLDFEQNFFTGFDDNTSPQITPAFLPTLSPPPSAFLGPKCALWDCPRPAQNWCSERPVHGWYPDYCSSLHAAIAQNEGRFGMTPVIRPKGIELKDTLLFAALSAKTQGK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010284 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010284 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:143661987-143663542 (+) | |||||||||
| Description | Similar to VOZ1: Transcription factor VOZ1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0009408 response to heat Biological Process GO:0009414 response to water deprivation Biological Process GO:0009585 red, far-red light phototransduction Biological Process GO:0009631 cold acclimation Biological Process GO:0009651 response to salt stress Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0048574 long-day photoperiodism, flowering Biological Process GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G28520 ath:AT2G42400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28235.1VOZ_N22-58 aaPF29201.1VOZ_C183-378 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010284 | PF28235.1 | VOZ_N | 22 | 58 | 1.3e-22 | 79.8 |
| LXL04_010284 | PF29201.1 | VOZ_C | 183 | 378 | 6.7e-111 | 369.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.