TkA07G045090 | RubberDandelionOmics

Gene overview

TkA07G045090

Reference: TK1151 Chr: Chr07 Coordinates: 12020262-12021350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1089 bp · TkA07G045090|TK1151|cDNA

ATGGAAGACAGACTCACTAACTTACCCGAAGATCTAAAGCTTTGTATTCTCTCTTCTCTTGACACAAAACACGCGGTCCTAACATCGACCCTATCAAAATCATGGCTTCCTTTATGGACTCGAATCCCTGTTCTAGAATTCAACTACTTTGCTTTCCGTCAACTCCCAGGTTTCCAAGATTTCGTCAAGCAACTGTTGTGTCTTCGCGATCAAACCGCCAAGTTACAAAGATTAAGCCTCACCGGAATCGGAACGTGCGA...

CDS

Download CDS FASTA

1089 bp · TkA07G045090|TK1151|CDS

ATGGAAGACAGACTCACTAACTTACCCGAAGATCTAAAGCTTTGTATTCTCTCTTCTCTTGACACAAAACACGCGGTCCTAACATCGACCCTATCAAAATCATGGCTTCCTTTATGGACTCGAATCCCTGTTCTAGAATTCAACTACTTTGCTTTCCGTCAACTCCCAGGTTTCCAAGATTTCGTCAAGCAACTGTTGTGTCTTCGCGATCAAACCGCCAAGTTACAAAGATTAAGCCTCACCGGAATCGGAACGTGCGA...

Protein

Download Protein FASTA

362 aa · TkA07G045090|TK1151|PROTEIN

MEDRLTNLPEDLKLCILSSLDTKHAVLTSTLSKSWLPLWTRIPVLEFNYFAFRQLPGFQDFVKQLLCLRDQTAKLQRLSLTGIGTCDVKFIKNFLDYAFNHSVEELEVKICQICKYHSWPVYLNTFCDSLKSLKLQSVIEMSCPFLGAISRFKNLRVLYLQRALITNLEPFLGFPVLEKLTLANCDINTMGKTLSVHGPNLSYLKISDCRSFNCCELTTPNLRFFVYHGSDFPQLRAYGLGLPVLDTISLDFHPDGDMKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G045090`
TK1151 ID	TkA07G045090
OH-1004 ID	LXL04_027297
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 95.263 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G045090

Location Chr07:12020262-12021350 (+)

Description Similar to At5g53840: F-box/FBD/LRR-repeat protein At5g53840

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55660`	F-box/LRR-repeat protein At1g55660.	No verified direct reference in this release
`At3g58940`	F-box/LRR-repeat protein At3g58940.	No verified direct reference in this release
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At3g49030`	Putative F-box/FBD/LRR-repeat protein At3g49030.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027297 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G04230

ath:AT3G26922

ath:AT3G51530

ath:AT5G22700

ath:AT5G53840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.821

Rank 1 · TkA07G045090 · TK1151

Cytoplasm0.226

Rank 2 · TkA07G045090 · TK1151

Endoplasmic reticulum0.037

Rank 3 · TkA07G045090 · TK1151

Cell membrane0.036

Rank 4 · TkA07G045090 · TK1151

Plastid0.017

Rank 5 · TkA07G045090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box5-42 aa

PF12937F-box-like6-35 aa

PF23622LRR_At1g61320_AtMIF173-235 aa

PF12799LRR_474-82 aa

PF25019LRR_R13L1-DRL21101-161 aa

PF12799LRR_4129-171 aa

PF13855LRR_8129-135 aa

PF25019LRR_R13L1-DRL21129-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G045090	`PF00646`	F-box	5	42	1.3e-05	25.6
TkA07G045090	`PF12937`	F-box-like	6	35	0.068	13.7
TkA07G045090	`PF23622`	LRR_At1g61320_AtMIF1	73	235	3.3e-10	40.6
TkA07G045090	`PF12799`	LRR_4	74	82	0.00013	22.8
TkA07G045090	`PF25019`	LRR_R13L1-DRL21	101	161	0.046	14.3
TkA07G045090	`PF12799`	LRR_4	129	171	0.00013	22.8
TkA07G045090	`PF13855`	LRR_8	129	135	0.0017	18.8
TkA07G045090	`PF25019`	LRR_R13L1-DRL21	129	185	0.046	14.3
TkA07G045090	`PF24758`	LRR_At5g56370	144	232	0.00046	20.6
TkA07G045090	`PF12799`	LRR_4	153	188	0.00013	22.8
TkA07G045090	`PF13855`	LRR_8	154	209	0.0017	18.8
TkA07G045090	`PF25019`	LRR_R13L1-DRL21	175	215	0.046	14.3
TkA07G045090	`PF12799`	LRR_4	177	209	0.00013	22.8
TkA07G045090	`PF25019`	LRR_R13L1-DRL21	245	285	0.046	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PFK0`	Arabidopsis thaliana	sp\|Q1PFK0\|FBL32_ARATH F-box/LRR-repeat protein At1g55660	28.400%	Swiss-Prot	Low
`Q9LXQ8`	Arabidopsis thaliana	sp\|Q9LXQ8\|FBL60_ARATH F-box/LRR-repeat protein At3g58940	29.200%	Swiss-Prot	Low
`Q9SV82`	Arabidopsis thaliana	sp\|Q9SV82\|FBD40_ARATH FBD-associated F-box protein At4g10400	28.000%	Swiss-Prot	Low
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	28.500%	Swiss-Prot	Low
`Q9SMU0`	Arabidopsis thaliana	sp\|Q9SMU0\|FDL18_ARATH Putative F-box/FBD/LRR-repeat protein At3g49030	29.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card