TkA07G041050 | RubberDandelionOmics

Gene overview

TkA07G041050

Reference: TK1151 Chr: Chr07 Coordinates: 10990621-10992083 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1069 bp · TkA07G041050|TK1151|cDNA

CTAATTATACCTTAACACCCACGACTCTGCCCCACTATAGAATTCGGCGTGTATAAAACCCCCCAAAATCCCACCGGATCTTCCCTCAGTCTCATTTCAACCGCTCTGTGTTCTTGTCAAAGCTCTAATTTCCGATCAAATTCCGGTAGCTTAGCAGAAGCTTCATATTTGTAACCTTTATATATTCCGGACTAAATCCACATCAAAAATGGCAATGGAATACGATAACTATATCACTGATGAATTTAAACCCGAGAAAT...

CDS

Download CDS FASTA

603 bp · TkA07G041050|TK1151|CDS

ATGGCAATGGAATACGATAACTATATCACTGATGAATTTAAACCCGAGAAATCATCGCCCTGTTTTGACTGCAGTATCTGCCTCGACTTCGCTAAAGACCCTGTCGTGACTCTCTGCGGCCACCTCTATTGCTGGCCGTGTATCTACAAATGGCTAACTTTCCCCACCGATTCCGGCGACAATCCGCCATGCCCCGTCTGCAAATCCGAAATATCCCACACCTCCGTCGTCCCTCTTTACGGCCGCGGCAAAACATTCTC...

Protein

Download Protein FASTA

200 aa · TkA07G041050|TK1151|PROTEIN

MAMEYDNYITDEFKPEKSSPCFDCSICLDFAKDPVVTLCGHLYCWPCIYKWLTFPTDSGDNPPCPVCKSEISHTSVVPLYGRGKTFSDNEPSGKAPNTTAVIPPRPHAALSSPPNSVRESPYGSYGEIVDAYDSNVGMYGEMIYARVFGNSQSLYTFPNSYHLAGSNSPRLRGREMQLDRSLNRLTIFLFCCFFMCLLLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G041050`
TK1151 ID	TkA07G041050
OH-1004 ID	LXL04_027238
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 82.500 / OH-1004 42.746 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G041050

Location Chr07:10990621-10992083 (-)

Description Similar to At3g02770: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03510`	E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of aquaporin PIP2-1.	Rma1, a novel type of RING finger protein conserved from Arabidopsis to human, is a membrane-bound ubiquitin ligase.2001 · DOI: 10.1242/jcs.114.10.1949 Characterization of three Arabidopsis homologs of human RING membrane anchor E3 ubiquitin ligase.2009 · DOI: 10.1007/s00299-009-0680-8 Drought stress-induced Rma1H1, a RING membrane-anchor E3 ubiquitin ligase homolog, regulates aquaporin levels via ubiquitination in transgenic Arabidopsis plants.2009 · DOI: 10.1105/tpc.108.061994
`At4g27470`	E3 ubiquitin-protein ligase.	Characterization of three Arabidopsis homologs of human RING membrane anchor E3 ubiquitin ligase.2009 · DOI: 10.1007/s00299-009-0680-8
`At4g28270`	E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of the auxin-binding protein ERABP1.	Characterization of three Arabidopsis homologs of human RING membrane anchor E3 ubiquitin ligase.2009 · DOI: 10.1007/s00299-009-0680-8 In vitro and in vivo interaction of AtRma2 E3 ubiquitin ligase and auxin binding protein 1.2010 · DOI: 10.1016/j.bbrc.2010.02.032

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027238 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051252 regulation of RNA metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0008428 ribonuclease inhibitor activity Molecular Function

GO:0008948 oxaloacetate decarboxylase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0047443 4-hydroxy-4-methyl-2-oxoglutarate aldolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G02770

ath:AT5G16450

ath:AT5G56260

bmj:BMULJ_02024

bmu:Bmul_1223

reu:Reut_A1963

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.340

Rank 1 · TkA07G041050 · TK1151

Nucleus0.302

Rank 2 · TkA07G041050 · TK1151

Cytoplasm0.189

Rank 3 · TkA07G041050 · TK1151

Cell membrane0.163

Rank 4 · TkA07G041050 · TK1151

Lysosome / Vacuole0.154

Rank 5 · TkA07G041050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12678zf-rbx119-68 aa

PF13639zf-RING_223-68 aa

PF00097zf-C3HC424-67 aa

PF13923zf-C3HC4_224-67 aa

PF13445zf-RING_UBOX24-51 aa

PF13920zf-C3HC4_324-73 aa

PF24921RING_XB3-XBAT3124-72 aa

PF15227zf-C3HC4_424-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G041050	`PF12678`	zf-rbx1	19	68	0.018	16.0
TkA07G041050	`PF13639`	zf-RING_2	23	68	7.1e-09	36.5
TkA07G041050	`PF00097`	zf-C3HC4	24	67	3.1e-11	43.7
TkA07G041050	`PF13923`	zf-C3HC4_2	24	67	2.2e-09	37.7
TkA07G041050	`PF13445`	zf-RING_UBOX	24	51	7.1e-09	36.2
TkA07G041050	`PF13920`	zf-C3HC4_3	24	73	5.7e-08	33.2
TkA07G041050	`PF24921`	RING_XB3-XBAT31	24	72	6.2e-08	33.3
TkA07G041050	`PF15227`	zf-C3HC4_4	24	67	1.7e-07	31.9
TkA07G041050	`PF14634`	zf-RING_5	24	68	2.5e-05	24.9
TkA07G041050	`PF14447`	Prok-RING_4	24	75	0.00022	21.7
TkA07G041050	`PF21362`	Sina_RING	24	50	1.1	10.1
TkA07G041050	`PF12861`	zf-ANAPC11	34	71	0.032	15.0
TkA07G041050	`PF13923`	zf-C3HC4_2	64	76	2.2e-09	37.7
TkA07G041050	`PF13445`	zf-RING_UBOX	64	72	7.1e-09	36.2
TkA07G041050	`PF21362`	Sina_RING	64	68	1.1	10.1
TkA07G041050	`PF13920`	zf-C3HC4_3	186	196	5.7e-08	33.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64425`	Arabidopsis thaliana	sp\|O64425\|RMA1_ARATH E3 ubiquitin-protein ligase RMA1	38.600%	Swiss-Prot	Medium
`Q8GUK7`	Arabidopsis thaliana	sp\|Q8GUK7\|RMA3_ARATH E3 ubiquitin-protein ligase RMA3	40.600%	Swiss-Prot	Medium
`P93030`	Arabidopsis thaliana	sp\|P93030\|RMA2_ARATH E3 ubiquitin-protein ligase RMA2	38.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card