LXL04_027238 | RubberDandelionOmics

Gene overview

LXL04_027238

Reference: OH-1004 Chr: Chr06 Coordinates: 11532938-11540045 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1161 bp · LXL04_027238|LXL04_027238|OH1004|cDNA

ATGGCAATGGAATACGATAACTATATCACTGATGAATTTAAACCCGAGAAATCATCGCCCTGTTTTGACTGCAGTATCTGCCTCGACTTCGCTAAAGACCCTGTCGTGACTCTCTGCGGCCACCTCTATTGCTGGCCGTGTATCTACAAATGGCTAACTTTCCCCACCGATTCCGGCGACAATCCGCCATGCCCCGTCTGCAAATCCGAAATATCCCACACCTCCGTCGTCCCTCTTTACGGCCGCGGCAAAACATTCTC...

CDS

Download CDS FASTA

1161 bp · LXL04_027238|LXL04_027238|OH1004|CDS

ATGGCAATGGAATACGATAACTATATCACTGATGAATTTAAACCCGAGAAATCATCGCCCTGTTTTGACTGCAGTATCTGCCTCGACTTCGCTAAAGACCCTGTCGTGACTCTCTGCGGCCACCTCTATTGCTGGCCGTGTATCTACAAATGGCTAACTTTCCCCACCGATTCCGGCGACAATCCGCCATGCCCCGTCTGCAAATCCGAAATATCCCACACCTCCGTCGTCCCTCTTTACGGCCGCGGCAAAACATTCTC...

Protein

Download Protein FASTA

386 aa · LXL04_027238|LXL04_027238|OH1004|PROTEIN

MAMEYDNYITDEFKPEKSSPCFDCSICLDFAKDPVVTLCGHLYCWPCIYKWLTFPTDSGDNPPCPVCKSEISHTSVVPLYGRGKTFSDNEPSGKAPNTTAVIPPRPHAALSSPPNSVRESPYGSYGEIVDAYDSNVGMYGEMIYARVFGNSQSLYTFPNSYHLAGKCKNEIPFIDSSYFKFFSLGVAKITSNPANFWLDLDMALVTTAEVCDANPQLIVSGELRALQPVLQIYGRRQVFSGPVVTLKVFEDNVLIREFLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027238`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027238

Location Chr06:11532938-11540045 (-)

Description Similar to At3g02770: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02770`	Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate.	No verified direct reference in this release
`At5g16450`	Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate.	No verified direct reference in this release
`At5g56260`	Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027238 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0051252 regulation of RNA metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0008428 ribonuclease inhibitor activity Molecular Function

GO:0008948 oxaloacetate decarboxylase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0047443 4-hydroxy-4-methyl-2-oxoglutarate aldolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G02770

ath:AT5G16450

ath:AT5G56260

bmj:BMULJ_02024

bmu:Bmul_1223

reu:Reut_A1963

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.431

Rank 1 · LXL04_027238 · OH-1004

Cytoplasm0.414

Rank 2 · LXL04_027238 · OH-1004

Cell membrane0.118

Rank 3 · LXL04_027238 · OH-1004

Plastid0.069

Rank 4 · LXL04_027238 · OH-1004

Endoplasmic reticulum0.069

Rank 5 · LXL04_027238 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_223-68 aa

PF00097.32zf-C3HC424-67 aa

PF13923.13zf-C3HC4_224-67 aa

PF13445.13zf-RING_UBOX24-51 aa

PF13920.13zf-C3HC4_324-73 aa

PF24921.2RING_XB3-XBAT3124-72 aa

PF15227.13zf-C3HC4_424-67 aa

PF03737.22RraA-like207-360 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027238	`PF13639.13`	zf-RING_2	23	68	2.4e-08	34.8
LXL04_027238	`PF00097.32`	zf-C3HC4	24	67	9.9e-11	42.0
LXL04_027238	`PF13923.13`	zf-C3HC4_2	24	67	1.3e-08	35.2
LXL04_027238	`PF13445.13`	zf-RING_UBOX	24	51	2.7e-08	34.4
LXL04_027238	`PF13920.13`	zf-C3HC4_3	24	73	8.7e-08	32.6
LXL04_027238	`PF24921.2`	RING_XB3-XBAT31	24	72	1.8e-07	31.8
LXL04_027238	`PF15227.13`	zf-C3HC4_4	24	67	6.2e-07	30.1
LXL04_027238	`PF03737.22`	RraA-like	207	360	3.4e-43	148.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8R9`	Arabidopsis thaliana	Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1	83.133%	Swiss-Prot	weak database homology
`Q9FFE0`	Arabidopsis thaliana	Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 2	82.530%	Swiss-Prot	weak database homology
`Q9FH13`	Arabidopsis thaliana	Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3	70.482%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card