TkA07G041040 | RubberDandelionOmics

Gene overview

TkA07G041040

Reference: TK1151 Chr: Chr07 Coordinates: 10985345-10987619 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

871 bp · TkA07G041040|TK1151|cDNA

AGTTGCAATATTTGAGGGGATGTTTTAGGAAATTGTTGGAAGTCGAGGGGTAACAGTTGAAGAAAAAAGTCAAAAACATAAAGTCAGTCTTCTCTCGATCATTTTCCACTAATCCAACGTCGTCACTCGTCTGCTGATTCTCTCGATCTGGACATGGCCTTGGTCACAACCGCGGAAGTCTGCGATGCAAACCCTCAATTAATCGTAAGCGGCGAACTGCGCGCACTCCAACCCGTCCTCCAAATCTACGGTAGGCGACA...

CDS

Download CDS FASTA

501 bp · TkA07G041040|TK1151|CDS

ATGGCCTTGGTCACAACCGCGGAAGTCTGCGATGCAAACCCTCAATTAATCGTAAGCGGCGAACTGCGCGCACTCCAACCCGTCCTCCAAATCTACGGTAGGCGACAAGTATTCTCAGGTCCCGTAGTCACTCTCAAAGTCTTCGAAGACAACGTGTTAATCCGTGAGTTTCTAGAAGAAAAGGGAAACGGGCGGGTTTTGGTGGTGGACGGTGGAGGGAGCTTACGGTGCGCCATACTGGGCGGTAACCCTGTGGTGCA...

Protein

Download Protein FASTA

166 aa · TkA07G041040|TK1151|PROTEIN

MALVTTAEVCDANPQLIVSGELRALQPVLQIYGRRQVFSGPVVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNGCVRDVDEINSCDIGVRALASHPVKANKKGIGEKHVSVMIGGTRISDGEYLYADTDGILISKTELSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G041040`
TK1151 ID	TkA07G041040
OH-1004 ID	LXL04_027238
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 43.005 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G041040

Location Chr07:10985345-10987619 (-)

Description Similar to At3g02770: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02770`	Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate.	No verified direct reference in this release
`At5g16450`	Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate.	No verified direct reference in this release
`At5g56260`	Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027238 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051252 regulation of RNA metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0008428 ribonuclease inhibitor activity Molecular Function

GO:0008948 oxaloacetate decarboxylase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0047443 4-hydroxy-4-methyl-2-oxoglutarate aldolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G02770

ath:AT5G16450

ath:AT5G56260

bmj:BMULJ_02024

bmu:Bmul_1223

reu:Reut_A1963

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.590

Rank 1 · TkA07G041040 · TK1151

Nucleus0.332

Rank 2 · TkA07G041040 · TK1151

Mitochondrion0.121

Rank 3 · TkA07G041040 · TK1151

Cell membrane0.076

Rank 4 · TkA07G041040 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA07G041040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03737RraA-like6-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G041040	`PF03737`	RraA-like	6	159	3.6e-44	151.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8R9`	Arabidopsis thaliana	sp\|Q9M8R9\|RRAA1_ARATH Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 1	83.700%	Swiss-Prot	High
`Q9FFE0`	Arabidopsis thaliana	sp\|Q9FFE0\|RRAA2_ARATH Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 2	83.100%	Swiss-Prot	High
`Q9FH13`	Arabidopsis thaliana	sp\|Q9FH13\|RRAA3_ARATH Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase 3	71.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card