TkA07G035310 | RubberDandelionOmics

Gene overview

TkA07G035310

Reference: TK1151 Chr: Chr07 Coordinates: 9397814-9398631 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · TkA07G035310|TK1151|cDNA

GGATACAAATCAAGTCAAGCGGACGTTTCTTCAAACACATGCTCGGAGTGTTTGACTAAATCAACCAGCATACCTTTAAGGGATTGTCCCGAAATCAAAGACCTAGTAATATGGGCGAGTTTGTGTAGTTTAAGGTTCTCAAACACGAGTTTCTTTGGTGAACTCTGGAACAGCTCTTCGTCATCAAGCTCTAATGGTCATGGACTTGATGAACCTTCGGTGTTTTCAAGAGGGTTTGCGATGATGGAGGAATTAGGAAG...

CDS

Download CDS FASTA

603 bp · TkA07G035310|TK1151|CDS

GGATACAAATCAAGTCAAGCGGACGTTTCTTCAAACACATGCTCGGAGTGTTTGACTAAATCAACCAGCATACCTTTAAGGGATTGTCCCGAAATCAAAGACCTAGTAATATGGGCGAGTTTGTGTAGTTTAAGGTTCTCAAACACGAGTTTCTTTGGTGAACTCTGGAACAGCTCTTCGTCATCAAGCTCTAATGGTCATGGACTTGATGAACCTTCGGTGTTTTCAAGAGGGTTTGCGATGATGGAGGAATTAGGAAG...

Protein

Download Protein FASTA

200 aa · TkA07G035310|TK1151|PROTEIN

GYKSSQADVSSNTCSECLTKSTSIPLRDCPEIKDLVIWASLCSLRFSNTSFFGELWNSSSSSSSNGHGLDEPSVFSRGFAMMEELGRNVSSQPLMFDTGVVDVGNDGKRYGFGQCSRDLSETDCENCFGELLTTYRRLVLNRTGWEMLGVSCGLWYDDVRFDGNYSGLTPTPIGSGGGERWSKGDVILGFVAFLLLHWIA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G035310`
TK1151 ID	TkA07G035310
OH-1004 ID	LXL04_027145
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.900
Protein coverage (%)	TK1151 97.500 / OH-1004 70.652 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G035310

Location Chr07:9397814-9398631 (+)

Description Similar to CRRSP38: Cysteine-rich repeat secretory protein 38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48540`	Cysteine-rich repeat secretory protein 55.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027145 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G22060

ath:AT3G58310

ath:AT4G05200

ath:AT4G23190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.833

Rank 1 · TkA07G035310 · TK1151

Endoplasmic reticulum0.096

Rank 2 · TkA07G035310 · TK1151

Cytoplasm0.066

Rank 3 · TkA07G035310 · TK1151

Nucleus0.042

Rank 4 · TkA07G035310 · TK1151

Extracellular0.041

Rank 5 · TkA07G035310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung7-48 aa

PF01657Stress-antifung83-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G035310	`PF01657`	Stress-antifung	7	48	5.8e-14	53.3
TkA07G035310	`PF01657`	Stress-antifung	83	157	5.8e-14	53.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV60`	Arabidopsis thaliana	sp\|Q9LV60\|CRR55_ARATH Cysteine-rich repeat secretory protein 55	25.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card