TkA07G033090 | RubberDandelionOmics

Gene overview

TkA07G033090

Reference: TK1151 Chr: Chr07 Coordinates: 8820133-8820776 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

621 bp · TkA07G033090|TK1151|cDNA

GTCAAACAAAATCAATTTTGGAATATTGCTCATCGTTCCCGTTCCATTTTTTAGGTCAAACAAAATCAATTTTTTAGGTCCAACAAAATCAGTTTTTAGGTCCCCTTAGCACAAGTAGGAAAGTCCAAGTACATTTGCGGATCTCAAATGGCTCTAAGCTTCACCGATGATAATTCACTTTTCAACTTCGTTGTGAAAGAAGGCAATGGTATCAAAGGTCTGGTTGACTCCGGGATCACGGAGGTACCACCTCGGTTCAT...

CDS

Download CDS FASTA

474 bp · TkA07G033090|TK1151|CDS

ATGGCTCTAAGCTTCACCGATGATAATTCACTTTTCAACTTCGTTGTGAAAGAAGGCAATGGTATCAAAGGTCTGGTTGACTCCGGGATCACGGAGGTACCACCTCGGTTCATCCAACCTCCCGACTATCGATTCAACAAGCAACAATCATCCTCACCATATGAAACCATGACCATTGATCTATCGGAGCTTGATGTTCCTAACCATGATCAAGTGGTCAAGGACATAGTCCATGCTGCCGAAACACTAGGCTTCTTACA...

Protein

Download Protein FASTA

158 aa · TkA07G033090|TK1151|PROTEIN

MALSFTDDNSLFNFVVKEGNGIKGLVDSGITEVPPRFIQPPDYRFNKQQSSSPYETMTIDLSELDVPNHDQVVKDIVHAAETLGFLQVVNHGVPLDLLDSLKTAVHEFFNQPPEIKAAYLDGVTPNPTVKYATSFFPANEKKWMWRDFLKMTYTNDLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G033090`
TK1151 ID	TkA07G033090
OH-1004 ID	LXL04_027101
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 94.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G033090

Location Chr07:8820133-8820776 (+)

Description Similar to S8H: Scopoletin 8-hydroxylase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12900`	Involved in the pathway of sideretin biosynthesis from feruloyl CoA, a redox-active catecholic metabolite exuded by roots in response to iron deficiency in order to facilitate the uptake of iron; this pathway consists in the successive conversion from feruloyl CoA to scopoletin, from scopoletin to fraxetin and from fraxetin to sideretin.	No verified direct reference in this release
`At3g13610`	May act as a 2-oxoglutarate- and Fe²⁺-dependent dioxygenase in scopoletin biosynthesis.	Scopoletin is biosynthesized via ortho-hydroxylation of feruloyl CoA by a 2-oxoglutarate-dependent dioxygenase in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03568.x Mutually exclusive alterations in secondary metabolism are critical for the uptake of insoluble iron compounds by Arabidopsis and Medicago truncatula.2013 · DOI: 10.1104/pp.113.220426 Feruloyl-CoA 6'-Hydroxylase1-dependent coumarins mediate iron acquisition from alkaline substrates in Arabidopsis.2014 · DOI: 10.1104/pp.113.228544

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027101 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009620 response to fungus Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010039 response to iron ion Biological Process

GO:0010421 hydrogen peroxide-mediated programmed cell death Biological Process

GO:0010447 response to acidic pH Biological Process

GO:0106147 fraxetin biosynthesis Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

KEGG gene cross-reference

ag:BAL22347

ath:AT3G12900

ath:AT3G13610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.846

Rank 1 · TkA07G033090 · TK1151

Nucleus0.358

Rank 2 · TkA07G033090 · TK1151

Endoplasmic reticulum0.045

Rank 3 · TkA07G033090 · TK1151

Mitochondrion0.039

Rank 4 · TkA07G033090 · TK1151

Peroxisome0.033

Rank 5 · TkA07G033090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24376DUF753251-97 aa

PF14226DIOX_N58-154 aa

PF16007DUF477771-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G033090	`PF24376`	DUF7532	51	97	0.2	12.6
TkA07G033090	`PF14226`	DIOX_N	58	154	4.3e-20	73.2
TkA07G033090	`PF16007`	DUF4777	71	90	0.29	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LE86`	Arabidopsis thaliana	sp\|Q9LE86\|S8H_ARATH Scopoletin 8-hydroxylase	53.200%	Swiss-Prot	High
`Q9LHN8`	Arabidopsis thaliana	sp\|Q9LHN8\|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card