LXL04_027101 | RubberDandelionOmics

Gene overview

LXL04_027101

Reference: OH-1004 Chr: Chr06 Coordinates: 8963942-8964448 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_027101|LXL04_027101|OH1004|cDNA

ATGGCTCTAAGCTTCACCGATGATAATTCACTTTTCAACTTCGTTGTGAAAGAAGGCAATGGTATCAAAGGTCTGGTTGACTCCGGGATCACGGAGGTACCACCTCGGTTCATCCAACCTCCCGACTATCGATTCAACAAGCAACAATCATCCTCACCATATGAAACCATGACCATTGATCTATCGGAGCTTGATGGTCCTAACCATGATCAAGTGGTCAAGGACATAGTCCATGCTGCCGAAACACTAGGCTTCTTTCA...

CDS

Download CDS FASTA

507 bp · LXL04_027101|LXL04_027101|OH1004|CDS

ATGGCTCTAAGCTTCACCGATGATAATTCACTTTTCAACTTCGTTGTGAAAGAAGGCAATGGTATCAAAGGTCTGGTTGACTCCGGGATCACGGAGGTACCACCTCGGTTCATCCAACCTCCCGACTATCGATTCAACAAGCAACAATCATCCTCACCATATGAAACCATGACCATTGATCTATCGGAGCTTGATGGTCCTAACCATGATCAAGTGGTCAAGGACATAGTCCATGCTGCCGAAACACTAGGCTTCTTTCA...

Protein

Download Protein FASTA

168 aa · LXL04_027101|LXL04_027101|OH1004|PROTEIN

MALSFTDDNSLFNFVVKEGNGIKGLVDSGITEVPPRFIQPPDYRFNKQQSSSPYETMTIDLSELDGPNHDQVVKDIVHAAETLGFFQVVNHGIPLDLLDSLKTAVHEFFNQPPEIKAAYLDGVTPNPTVKYATSFFPANEKKWMWRDFLKMTYTNDLDALEFWPNEIK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027101`
TK1151 ID	TkA07G033090
OH-1004 ID	LXL04_027101
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 94.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027101

Location Chr06:8963942-8964448 (+)

Description Similar to S8H: Scopoletin 8-hydroxylase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12900`	Involved in the pathway of sideretin biosynthesis from feruloyl CoA, a redox-active catecholic metabolite exuded by roots in response to iron deficiency in order to facilitate the uptake of iron; this pathway consists in the successive conversion from feruloyl CoA to scopoletin, from scopoletin to fraxetin and from fraxetin to sideretin.	No verified direct reference in this release
`At3g13610`	May act as a 2-oxoglutarate- and Fe²⁺-dependent dioxygenase in scopoletin biosynthesis.	Scopoletin is biosynthesized via ortho-hydroxylation of feruloyl CoA by a 2-oxoglutarate-dependent dioxygenase in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03568.x Mutually exclusive alterations in secondary metabolism are critical for the uptake of insoluble iron compounds by Arabidopsis and Medicago truncatula.2013 · DOI: 10.1104/pp.113.220426 Feruloyl-CoA 6'-Hydroxylase1-dependent coumarins mediate iron acquisition from alkaline substrates in Arabidopsis.2014 · DOI: 10.1104/pp.113.228544

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027101 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009620 response to fungus Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010039 response to iron ion Biological Process

GO:0010421 hydrogen peroxide-mediated programmed cell death Biological Process

GO:0010447 response to acidic pH Biological Process

GO:0106147 fraxetin biosynthesis Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

KEGG gene cross-reference

ag:BAL22347

ath:AT3G12900

ath:AT3G13610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.846

Rank 1 · LXL04_027101 · OH-1004

Nucleus0.365

Rank 2 · LXL04_027101 · OH-1004

Endoplasmic reticulum0.046

Rank 3 · LXL04_027101 · OH-1004

Mitochondrion0.038

Rank 4 · LXL04_027101 · OH-1004

Peroxisome0.032

Rank 5 · LXL04_027101 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N58-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027101	`PF14226.13`	DIOX_N	58	165	2.6e-22	80.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LE86`	Arabidopsis thaliana	Scopoletin 8-hydroxylase	52.976%	Swiss-Prot	strong database homology
`Q9LHN8`	Arabidopsis thaliana	Feruloyl CoA ortho-hydroxylase 1	37.952%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card