TkA07G033030 | RubberDandelionOmics

Gene overview

TkA07G033030

Reference: TK1151 Chr: Chr07 Coordinates: 8799632-8801082 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1357 bp · TkA07G033030|TK1151|cDNA

ATCTGAAGGAAATTTGTTAGTGTGGATGGACAGATGGTAATAACTCTTTTGCAAAACCCTACTTCCCCAATAAACCCCTAATCCCATCGGCAAAATTTTCTCTTCGGAACAACAATGGCTTCCAACATTATCTTTCGACGATTCAATTCCTTTCGTCATTTTCAAGCTCGGTTTTTCTCCTCAGTTCTAAACCCTGATTCCACCACTCCTCTCTCCAGCAAAGAGAAATCACGCGCCGCTCTTTCTCTCCTCAAAAGGGA...

CDS

Download CDS FASTA

624 bp · TkA07G033030|TK1151|CDS

ATGGTGAACAAGAACTGTAAACCAAACGCAACCACATTCGGTACATTAATCGCCGGATTTTACAAGGAGGAAAAGCTTGAAGAAGTCGGAAACGTCTTAAACCTAATGAGGAAACACGAAGTTCCTATAGGGATCTCAACATACAACACCAGAATCCAAAGCCTATGTAAGCTCAAGAGAACCAATGAAGCAAAAGAGTTACTCGATGGACTTATCTTAACTGGAATGAAACCTAATTCTGTTTCTTATTGTCATCTAAT...

Protein

Download Protein FASTA

207 aa · TkA07G033030|TK1151|PROTEIN

MVNKNCKPNATTFGTLIAGFYKEEKLEEVGNVLNLMRKHEVPIGISTYNTRIQSLCKLKRTNEAKELLDGLILTGMKPNSVSYCHLIHGYCKEGKLHEAKNLFHKMINSGFKPDSDCYFTMVSYLCKNGDFDEGLMVCKQSMEKDWVPNFSTMKMLVEGLAKISKVHDAKELVLKMKEKFPKNAHMWIEVEETLRKLEDTEMDSIDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G033030`
TK1151 ID	TkA07G033030
OH-1004 ID	LXL04_027098
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 35.749 / OH-1004 18.005 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G033030

Location Chr07:8799632-8801082 (+)

Description Similar to PPR336: Pentatricopeptide repeat-containing protein At1g61870, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11630`	Pentatricopeptide repeat-containing protein At1g11630, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027098 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005840 ribosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G11630

ath:AT1G55890

ath:AT1G61870

ath:AT2G18520

ath:AT4G36680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.851

Rank 1 · TkA07G033030 · TK1151

Nucleus0.076

Rank 2 · TkA07G033030 · TK1151

Plastid0.050

Rank 3 · TkA07G033030 · TK1151

Cytoplasm0.050

Rank 4 · TkA07G033030 · TK1151

Cell membrane0.016

Rank 5 · TkA07G033030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_21-22 aa

PF13812PPR_31-50 aa

PF17177PPR_long1-43 aa

PF29978ATP18_TPR2-21 aa

PF12854PPR_14-28 aa

PF13041PPR_28-57 aa

PF23276TPR_248-57 aa

PF09892DUF21199-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G033030	`PF13041`	PPR_2	1	22	3e-33	114.4
TkA07G033030	`PF13812`	PPR_3	1	50	1.6e-13	51.2
TkA07G033030	`PF17177`	PPR_long	1	43	0.0016	18.6
TkA07G033030	`PF29978`	ATP18_TPR	2	21	0.13	12.8
TkA07G033030	`PF12854`	PPR_1	4	28	1.1e-33	115.3
TkA07G033030	`PF13041`	PPR_2	8	57	3e-33	114.4
TkA07G033030	`PF23276`	TPR_24	8	57	5.2e-08	33.6
TkA07G033030	`PF09892`	DUF2119	9	62	0.15	12.2
TkA07G033030	`PF01535`	PPR	12	39	2.2e-26	90.9
TkA07G033030	`PF24760`	TPR_IF140_C	13	36	0.062	14.4
TkA07G033030	`PF17814`	LisH_TPL	16	27	0.25	11.7
TkA07G033030	`PF29070`	MSC6_N	18	68	5.2e-10	39.7
TkA07G033030	`PF06175`	MiaE	23	76	0.17	12.4
TkA07G033030	`PF29978`	ATP18_TPR	24	57	0.13	12.8
TkA07G033030	`PF13041`	PPR_2	45	83	3e-33	114.4
TkA07G033030	`PF25058`	ARM_TT21	45	69	0.00038	21.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAB4`	Arabidopsis thaliana	sp\|Q9SAB4\|PPR33_ARATH Pentatricopeptide repeat-containing protein At1g11630, mitochondrial	51.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card