TkA07G029770 | RubberDandelionOmics

Gene overview

TkA07G029770

Reference: TK1151 Chr: Chr07 Coordinates: 7966027-7967162 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · TkA07G029770|TK1151|cDNA

AAAGCATCTGATCAAGAATTTGAACAAGAACAAAATGATGTGAAGGCGACACATGGCCATCATAAAAGAAATGCTAGTTTAGCTCATAAGGATTTGGCGTCATTTGCTGATGACTACAGAAAGCTAGCAATTGATTGCCTTAAAGTTCTTCGTCTGGAGATGCAACTAGAAACGGTTTTCAATATGCAGGTAATGGCAACAAGGGAATACTTGGAGGACCAAGATGCTGAAGAACCTGATGATTATGTTGTATCTTTAAT...

CDS

Download CDS FASTA

633 bp · TkA07G029770|TK1151|CDS

AAAGCATCTGATCAAGAATTTGAACAAGAACAAAATGATGTGAAGGCGACACATGGCCATCATAAAAGAAATGCTAGTTTAGCTCATAAGGATTTGGCGTCATTTGCTGATGACTACAGAAAGCTAGCAATTGATTGCCTTAAAGTTCTTCGTCTGGAGATGCAACTAGAAACGGTTTTCAATATGCAGGTAATGGCAACAAGGGAATACTTGGAGGACCAAGATGCTGAAGAACCTGATGATTATGTTGTATCTTTAAT...

Protein

Download Protein FASTA

210 aa · TkA07G029770|TK1151|PROTEIN

KASDQEFEQEQNDVKATHGHHKRNASLAHKDLASFADDYRKLAIDCLKVLRLEMQLETVFNMQVMATREYLEDQDAEEPDDYVVSLITQITRRDEAIGPFIAPTKRNYVFGGICTVASHASIKALAEMKRINLFGVQQICRNTIALEQALSAIPSIDSESVQMRLDHVRTYYELLNMPVEALLAFVAEHDTLFTAIEYAHIFIYLKKWCL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G029770`
TK1151 ID	TkA07G029770
OH-1004 ID	LXL04_012584
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 94.286 / OH-1004 18.557 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G029770

Location Chr07:7966027-7967162 (+)

Description Similar to SEC8: Exocyst complex component SEC8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10380`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000212 meiotic spindle organization Biological Process

GO:0000281 mitotic cytokinesis Biological Process

GO:0000916 actomyosin contractile ring contraction Biological Process

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0007009 plasma membrane organization Biological Process

GO:0007110 meiosis I cytokinesis Biological Process

GO:0007111 meiosis II cytokinesis Biological Process

GO:0007286 spermatid development Biological Process

GO:0015031 protein transport Biological Process

GO:0016080 synaptic vesicle targeting Biological Process

KEGG gene cross-reference

ath:AT3G10380

dme:Dmel_CG2095

hsa:60412

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.593

Rank 1 · TkA07G029770 · TK1151

Nucleus0.327

Rank 2 · TkA07G029770 · TK1151

Cell membrane0.188

Rank 3 · TkA07G029770 · TK1151

Lysosome / Vacuole0.152

Rank 4 · TkA07G029770 · TK1151

Golgi apparatus0.099

Rank 5 · TkA07G029770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10474Syndetin_C31-194 aa

PF26942DUF829338-63 aa

PF26942DUF8293123-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G029770	`PF10474`	Syndetin_C	31	194	0.0015	18.9
TkA07G029770	`PF26942`	DUF8293	38	63	0.24	12.6
TkA07G029770	`PF26942`	DUF8293	123	187	0.24	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YU5`	Arabidopsis thaliana	sp\|Q93YU5\|SEC8_ARATH Exocyst complex component SEC8	69.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card