TkA07G028890 | RubberDandelionOmics

Gene overview

TkA07G028890

Reference: TK1151 Chr: Chr07 Coordinates: 7753909-7755356 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1355 bp · TkA07G028890|TK1151|cDNA

CTTTAAAACACTCTCCATTTGTGTCTCCAAAACCTTAAAAAAAACGTACTTTCCGTAACTCCAACAATGGTGCACCCCGAAATAGGGTTAGAAGTTGTTATTGACCCTTCATCTATCATCAAACATCAAGAACTACCCACAAAGAAGACGAATCTTAAAAACCACGAAATGAAGCGATCACAAAAACCCATTATAACAAAGATCAATGCAGGGTACTTTAGGATTTGCATGTCGCTTGGTGGTCAAGCTTTGTTATGGAA...

CDS

Download CDS FASTA

1134 bp · TkA07G028890|TK1151|CDS

ATGGTGCACCCCGAAATAGGGTTAGAAGTTGTTATTGACCCTTCATCTATCATCAAACATCAAGAACTACCCACAAAGAAGACGAATCTTAAAAACCACGAAATGAAGCGATCACAAAAACCCATTATAACAAAGATCAATGCAGGGTACTTTAGGATTTGCATGTCGCTTGGTGGTCAAGCTTTGTTATGGAAAACTCTAAGTGAACAAGTTGATATATCACCAACGATTAATAACGTGTTCACGAAGTTACCATTAAC...

Protein

Download Protein FASTA

377 aa · TkA07G028890|TK1151|PROTEIN

MVHPEIGLEVVIDPSSIIKHQELPTKKTNLKNHEMKRSQKPIITKINAGYFRICMSLGGQALLWKTLSEQVDISPTINNVFTKLPLTAYFLIWCLALCVFISLSTLYLFRCIFHFNMVKGEYHHHVGVNYLYAPWVSALLLLRSAPSFIFPNKYSYEYVWWPLILPVIALDVKIYGQWFTTEKRFLSMVANPTSQLSVIGNLVGAHAAVKIGWTESGICLFTLGMTHYLVVFITLYQRFSGNNHLPSRLRPVFFLFVATP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G028890`
TK1151 ID	TkA07G028890
OH-1004 ID	LXL04_027053
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.878 / OH-1004 90.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G028890

Location Chr07:7753909-7755356 (+)

Description Similar to SLAH1: S-type anion channel SLAH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62280`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At1g62262`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At1g12480`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	CO2 regulator SLAC1 and its homologues are essential for anion homeostasis in plant cells.2008 · DOI: 10.1038/nature06720 SLAC1 is required for plant guard cell S-type anion channel function in stomatal signalling.2008 · DOI: 10.1038/nature06608 Ozone-triggered rapid stomatal response involves the production of reactive oxygen species, and is controlled by SLAC1 and OST1.2010 · DOI: 10.1111/j.1365-313x.2010.04159.x Stomatal action directly feeds back on leaf turgor: new insights into the regulation of the plant water status from non-invasive pressure probe measurements.2010 · DOI: 10.1111/j.1365-313x.2010.04213.x S-type Anion Channels SLAC1 and SLAH3 Function as Essential Negative Regulators of Inward K+ Channels and Stomatal Opening in Arabidopsis.2016 · DOI: 10.1105/tpc.16.01050 Coordinating the overall stomatal response of plants: Rapid leaf-to-leaf communication during light stress.2018 · DOI: 10.1126/scisignal.aam9514
`At5g24030`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	S-type Anion Channels SLAC1 and SLAH3 Function as Essential Negative Regulators of Inward K+ Channels and Stomatal Opening in Arabidopsis.2016 · DOI: 10.1105/tpc.16.01050
`At4g27970`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027053 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0006821 chloride transport Biological Process

GO:0006873 intracellular monoatomic ion homeostasis Biological Process

GO:0009270 response to humidity Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010193 response to ozone Biological Process

KEGG gene cross-reference

ath:AT1G12480

ath:AT1G62262

ath:AT1G62280

ath:AT4G27970

ath:AT5G24030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.723

Rank 1 · TkA07G028890 · TK1151

Endoplasmic reticulum0.142

Rank 2 · TkA07G028890 · TK1151

Cytoplasm0.091

Rank 3 · TkA07G028890 · TK1151

Lysosome / Vacuole0.090

Rank 4 · TkA07G028890 · TK1151

Golgi apparatus0.042

Rank 5 · TkA07G028890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03595SLAC147-357 aa

PF18415HKR_ArcB_TM53-93 aa

PF18415HKR_ArcB_TM94-136 aa

PF18415HKR_ArcB_TM210-260 aa

PF18415HKR_ArcB_TM341-360 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G028890	`PF03595`	SLAC1	47	357	1.9e-41	143.0
TkA07G028890	`PF18415`	HKR_ArcB_TM	53	93	8.4	7.8
TkA07G028890	`PF18415`	HKR_ArcB_TM	94	136	8.4	7.8
TkA07G028890	`PF18415`	HKR_ArcB_TM	210	260	8.4	7.8
TkA07G028890	`PF18415`	HKR_ArcB_TM	341	360	8.4	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5E930`	Arabidopsis thaliana	sp\|Q5E930\|SLAH1_ARATH S-type anion channel SLAH1	56.300%	Swiss-Prot	High
`A8MRV9`	Arabidopsis thaliana	sp\|A8MRV9\|SLAH4_ARATH S-type anion channel SLAH4	50.300%	Swiss-Prot	High
`Q9LD83`	Arabidopsis thaliana	sp\|Q9LD83\|SLAC1_ARATH Guard cell S-type anion channel SLAC1	43.100%	Swiss-Prot	Medium
`Q9FLV9`	Arabidopsis thaliana	sp\|Q9FLV9\|SLAH3_ARATH S-type anion channel SLAH3	39.300%	Swiss-Prot	Medium
`Q9ASQ7`	Arabidopsis thaliana	sp\|Q9ASQ7\|SLAH2_ARATH S-type anion channel SLAH2	37.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card