LXL04_027053 | RubberDandelionOmics

Gene overview

LXL04_027053

Reference: OH-1004 Chr: Chr06 Coordinates: 7968942-7970605 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · LXL04_027053|LXL04_027053|OH1004|cDNA

ATGGTGCACCCCGAAATAGGGTTAGAAGTTGTTATTGACCCTTCATCTATCATCAAACATCAAGAACTACCCACAAAGAAGACGAATCTTAAAAACCACGAAATGAAGCGATCACAAAAACCCATTATAACAAAGATCAATGCAGGGTACTTTAGGATTTGCATGTCGCTTGGTGGTCAAGCTTTGTTATGGAAAACTCTAAGTGAACAAGTTGATATATCACCAACGATTAATAACGTGTTCACGAAGTTACCATTAAC...

CDS

Download CDS FASTA

1233 bp · LXL04_027053|LXL04_027053|OH1004|CDS

ATGGTGCACCCCGAAATAGGGTTAGAAGTTGTTATTGACCCTTCATCTATCATCAAACATCAAGAACTACCCACAAAGAAGACGAATCTTAAAAACCACGAAATGAAGCGATCACAAAAACCCATTATAACAAAGATCAATGCAGGGTACTTTAGGATTTGCATGTCGCTTGGTGGTCAAGCTTTGTTATGGAAAACTCTAAGTGAACAAGTTGATATATCACCAACGATTAATAACGTGTTCACGAAGTTACCATTAAC...

Protein

Download Protein FASTA

410 aa · LXL04_027053|LXL04_027053|OH1004|PROTEIN

MVHPEIGLEVVIDPSSIIKHQELPTKKTNLKNHEMKRSQKPIITKINAGYFRICMSLGGQALLWKTLSEQVDISPTINNVFTKLPLTAYFLIWCLALCVFISLSTLYLFRCIFHFNMVKGEYHHHVGVNYLYAPWVSALLLLRSAPSFIFPNKYSYEYVWWPLILPVIALDVKIYGQWFTTEKRFLSMVANPTSQLSVIGNLVGAHAAVKIGWTESGICLFTLGMTHYLVVFITLYQRFSGNNHLPSRLRPVFFLFVATP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027053`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027053

Location Chr06:7968942-7970605 (+)

Description Similar to SLAH1: S-type anion channel SLAH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62280`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At1g62262`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At1g12480`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	CO2 regulator SLAC1 and its homologues are essential for anion homeostasis in plant cells.2008 · DOI: 10.1038/nature06720 SLAC1 is required for plant guard cell S-type anion channel function in stomatal signalling.2008 · DOI: 10.1038/nature06608 Ozone-triggered rapid stomatal response involves the production of reactive oxygen species, and is controlled by SLAC1 and OST1.2010 · DOI: 10.1111/j.1365-313x.2010.04159.x Stomatal action directly feeds back on leaf turgor: new insights into the regulation of the plant water status from non-invasive pressure probe measurements.2010 · DOI: 10.1111/j.1365-313x.2010.04213.x S-type Anion Channels SLAC1 and SLAH3 Function as Essential Negative Regulators of Inward K+ Channels and Stomatal Opening in Arabidopsis.2016 · DOI: 10.1105/tpc.16.01050 Coordinating the overall stomatal response of plants: Rapid leaf-to-leaf communication during light stress.2018 · DOI: 10.1126/scisignal.aam9514
`At5g24030`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	S-type Anion Channels SLAC1 and SLAH3 Function as Essential Negative Regulators of Inward K+ Channels and Stomatal Opening in Arabidopsis.2016 · DOI: 10.1105/tpc.16.01050
`At4g27970`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027053 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0006821 chloride transport Biological Process

GO:0006873 intracellular monoatomic ion homeostasis Biological Process

GO:0009270 response to humidity Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010193 response to ozone Biological Process

KEGG gene cross-reference

ath:AT1G12480

ath:AT1G62262

ath:AT1G62280

ath:AT4G27970

ath:AT5G24030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.677

Rank 1 · LXL04_027053 · OH-1004

Endoplasmic reticulum0.166

Rank 2 · LXL04_027053 · OH-1004

Lysosome / Vacuole0.105

Rank 3 · LXL04_027053 · OH-1004

Cytoplasm0.090

Rank 4 · LXL04_027053 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_027053 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03595.23SLAC147-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027053	`PF03595.23`	SLAC1	47	357	2.5e-41	142.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5E930`	Arabidopsis thaliana	S-type anion channel SLAH1	51.892%	Swiss-Prot	strong database homology
`A8MRV9`	Arabidopsis thaliana	S-type anion channel SLAH4	50.959%	Swiss-Prot	strong database homology
`Q9LD83`	Arabidopsis thaliana	Guard cell S-type anion channel SLAC1	41.570%	Swiss-Prot	moderate database homology
`Q9FLV9`	Arabidopsis thaliana	S-type anion channel SLAH3	39.329%	Swiss-Prot	moderate database homology
`Q9ASQ7`	Arabidopsis thaliana	S-type anion channel SLAH2	35.655%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card