TkA07G028520 | RubberDandelionOmics

Gene overview

TkA07G028520

Reference: TK1151 Chr: Chr07 Coordinates: 7670248-7672034 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

933 bp · TkA07G028520|TK1151|cDNA

ATGGCTCACCCCGAATCAAAACTAGATGTTGTCATCGACTCTCCAACAATCGAACATGTATCACAACCCATGAACCAATCAAATATCAAGAATCAAGAAAAACAATCAAAGAAATCCAATCATCCATCATCCATCATAGCCAACATCAATGCAAGCTACTTCAGGATTTGCATATCCCTTGCGGGCCAAGCTTTACTTTGGAAAACCCTAAGTGAAGAAACCAACATAGGAGCACCAACATTCCCTAACTTGTTCTTCAA...

CDS

Download CDS FASTA

933 bp · TkA07G028520|TK1151|CDS

ATGGCTCACCCCGAATCAAAACTAGATGTTGTCATCGACTCTCCAACAATCGAACATGTATCACAACCCATGAACCAATCAAATATCAAGAATCAAGAAAAACAATCAAAGAAATCCAATCATCCATCATCCATCATAGCCAACATCAATGCAAGCTACTTCAGGATTTGCATATCCCTTGCGGGCCAAGCTTTACTTTGGAAAACCCTAAGTGAAGAAACCAACATAGGAGCACCAACATTCCCTAACTTGTTCTTCAA...

Protein

Download Protein FASTA

310 aa · TkA07G028520|TK1151|PROTEIN

MAHPESKLDVVIDSPTIEHVSQPMNQSNIKNQEKQSKKSNHPSSIIANINASYFRICISLAGQALLWKTLSEETNIGAPTFPNLFFKCIFYTNMVKAEFHHHVGVNYLFAPWISCLLLLLSAPSFILRNKESCEYLWWLLIIPVICLDVKEPMQPLKWGGEKVRLSGSNHLPSKLRPVFFLFVAAPSMAALALKSIKGSFDVQCKMLFFLSLFLFASLVSRPTFFKKSVKEFSVAWWAFSFPTTFLALAATAYAQQVKSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G028520`
TK1151 ID	TkA07G028520
OH-1004 ID	LXL04_027053
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.900
Protein coverage (%)	TK1151 95.161 / OH-1004 90.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G028520

Location Chr07:7670248-7672034 (+)

Description Similar to SLAH1: S-type anion channel SLAH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62280`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At1g62262`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release
`At5g24030`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	S-type Anion Channels SLAC1 and SLAH3 Function as Essential Negative Regulators of Inward K+ Channels and Stomatal Opening in Arabidopsis.2016 · DOI: 10.1105/tpc.16.01050
`At4g27970`	Slow, weak voltage-dependent S-type anion efflux channel involved in maintenance of anion homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027053 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0006821 chloride transport Biological Process

GO:0006873 intracellular monoatomic ion homeostasis Biological Process

GO:0009270 response to humidity Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010193 response to ozone Biological Process

KEGG gene cross-reference

ath:AT1G12480

ath:AT1G62262

ath:AT1G62280

ath:AT4G27970

ath:AT5G24030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.714

Rank 1 · TkA07G028520 · TK1151

Endoplasmic reticulum0.183

Rank 2 · TkA07G028520 · TK1151

Cytoplasm0.075

Rank 3 · TkA07G028520 · TK1151

Lysosome / Vacuole0.071

Rank 4 · TkA07G028520 · TK1151

Nucleus0.048

Rank 5 · TkA07G028520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03595SLAC151-138 aa

PF03595SLAC1164-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G028520	`PF03595`	SLAC1	51	138	5.9e-18	65.8
TkA07G028520	`PF03595`	SLAC1	164	282	5.9e-18	65.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5E930`	Arabidopsis thaliana	sp\|Q5E930\|SLAH1_ARATH S-type anion channel SLAH1	39.100%	Swiss-Prot	Medium
`A8MRV9`	Arabidopsis thaliana	sp\|A8MRV9\|SLAH4_ARATH S-type anion channel SLAH4	39.600%	Swiss-Prot	Medium
`Q9FLV9`	Arabidopsis thaliana	sp\|Q9FLV9\|SLAH3_ARATH S-type anion channel SLAH3	31.500%	Swiss-Prot	Medium
`Q9ASQ7`	Arabidopsis thaliana	sp\|Q9ASQ7\|SLAH2_ARATH S-type anion channel SLAH2	42.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card