TkA07G024620 | RubberDandelionOmics

Gene overview

TkA07G024620

Reference: TK1151 Chr: Chr07 Coordinates: 6653832-6655432 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

907 bp · TkA07G024620|TK1151|cDNA

GTTGATGATTTTAGTCTACCAATTTGTGACCCGACAACCTACAACACGAATAAATATATAAATCATGTATCGGCATTTTTGCAAGTCTTTAAGAATTGAGAATATTTGATCGAATACACCTTTCATTTACATCTTCTTCGGCCAACTCAAGCCAAGACTAGACGATCCTTTTTACTTGTGATTCTGTAAAACGCTGCCCTCATCTCCTTCGTTCTTCTCCAAAACTCTCATCTGCGCTCCTGAAACCAGCCATCTCTACC...

CDS

Download CDS FASTA

348 bp · TkA07G024620|TK1151|CDS

ATGGATTCACAAACCCAGAATGCATCACTACAACGCCTCCAAACTGTTGAAAAGAGGATTGTTAGGGTACTAGAACTTGCTAGTGGTGTAATGGAAGAATTCTCAAATCCAAGTGGTCCAAGAAAAGAATTGGTCAACAATCACTGTAGCGAGTTCATGCAATTAATCAAGGATATACAAGTGACATTAAGGGAAGAAATCAAGAGCGCATGTGAATACCGTCCATTTGAGAAGTGTGATTACATTGCAAGAATATCAAA...

Protein

Download Protein FASTA

115 aa · TkA07G024620|TK1151|PROTEIN

MDSQTQNASLQRLQTVEKRIVRVLELASGVMEEFSNPSGPRKELVNNHCSEFMQLIKDIQVTLREEIKSACEYRPFEKCDYIARISNEICCQKVEYVLEKLEGMRESIDEYHNAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G024620`
TK1151 ID	TkA07G024620
OH-1004 ID	LXL04_027012
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G024620

Location Chr07:6653832-6655432 (+)

Description Similar to MED11: Mediator of RNA polymerase II transcription subunit 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01435`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027012 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003712 transcription coregulator activity Molecular Function

KEGG gene cross-reference

ath:AT3G01435

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.550

Rank 1 · TkA07G024620 · TK1151

Cytoplasm0.471

Rank 2 · TkA07G024620 · TK1151

Cell membrane0.049

Rank 3 · TkA07G024620 · TK1151

Lysosome / Vacuole0.045

Rank 4 · TkA07G024620 · TK1151

Golgi apparatus0.039

Rank 5 · TkA07G024620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25240PUB2_N4-62 aa

PF10280Med119-97 aa

PF16766CID_GANP45-99 aa

PF25240PUB2_N78-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G024620	`PF25240`	PUB2_N	4	62	0.072	13.8
TkA07G024620	`PF10280`	Med11	9	97	1.3e-19	71.6
TkA07G024620	`PF16766`	CID_GANP	45	99	0.05	14.7
TkA07G024620	`PF25240`	PUB2_N	78	103	0.072	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ID77`	Arabidopsis thaliana	sp\|Q6ID77\|MED11_ARATH Mediator of RNA polymerase II transcription subunit 11	73.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card