LXL04_027012 | RubberDandelionOmics

Gene overview

LXL04_027012

Reference: OH-1004 Chr: Chr06 Coordinates: 6914489-6915022 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · LXL04_027012|LXL04_027012|OH1004|cDNA

GCATGCAATAATCCCCAATTTTAATCAGAATTCATGGATTCACAAACCCAGAATGCATCACTACAACGCCTCCAAACTGTTGAAAAGAGGATTGTTAGGGTACTAGAACTTGCTAGTGGTGTAATGGAAGAATTCTCAAATCCAAGTGGTCCAAGAAAAGAATTGGTCAACAATCACTGTAGCGAGTTCATGCAATTAATCAAGGATATACAAGTGACATTAAGGGAAGAAATCAAGAGCGCATGTGAATACCGTCCATT...

CDS

Download CDS FASTA

348 bp · LXL04_027012|LXL04_027012|OH1004|CDS

ATGGATTCACAAACCCAGAATGCATCACTACAACGCCTCCAAACTGTTGAAAAGAGGATTGTTAGGGTACTAGAACTTGCTAGTGGTGTAATGGAAGAATTCTCAAATCCAAGTGGTCCAAGAAAAGAATTGGTCAACAATCACTGTAGCGAGTTCATGCAATTAATCAAGGATATACAAGTGACATTAAGGGAAGAAATCAAGAGCGCATGTGAATACCGTCCATTTGAGAAGTGTGATTACATTGCAAGAATATCAAA...

Protein

Download Protein FASTA

115 aa · LXL04_027012|LXL04_027012|OH1004|PROTEIN

MDSQTQNASLQRLQTVEKRIVRVLELASGVMEEFSNPSGPRKELVNNHCSEFMQLIKDIQVTLREEIKSACEYRPFEKCDYIARISNEICCQKVEYVLEKLEGMSESIDEYHNAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027012`
TK1151 ID	TkA07G024620
OH-1004 ID	LXL04_027012
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027012

Location Chr06:6914489-6915022 (+)

Description Similar to MED11: Mediator of RNA polymerase II transcription subunit 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01435`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027012 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003712 transcription coregulator activity Molecular Function

KEGG gene cross-reference

ath:AT3G01435

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.553

Rank 1 · LXL04_027012 · OH-1004

Cytoplasm0.467

Rank 2 · LXL04_027012 · OH-1004

Cell membrane0.047

Rank 3 · LXL04_027012 · OH-1004

Lysosome / Vacuole0.044

Rank 4 · LXL04_027012 · OH-1004

Golgi apparatus0.038

Rank 5 · LXL04_027012 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10280.15Med119-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027012	`PF10280.15`	Med11	9	100	1.1e-19	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ID77`	Arabidopsis thaliana	Mediator of RNA polymerase II transcription subunit 11	71.930%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card