TkA07G020680 | RubberDandelionOmics

Gene overview

TkA07G020680

Reference: TK1151 Chr: Chr07 Coordinates: 5584165-5585983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1248 bp · TkA07G020680|TK1151|cDNA

ATGTCAAACATGGAGAATCGGAAGCAATCAAGGACATCAGAAGACAGAGATGGTGTCGATATGATCAGTAAATTACCGGATCCTATTCTTCACTTAATTCTTTCACGTCTTCAAAGTACAGAAGAAGTAATTCGAACAAGCATTCTATCATCACGATGGAGACATTTATGGACTTCAGTTCCCTCTATAGACATAGACTATTCCCGAAGACTCAACCCCAATGAAGAATTCGAAAAGAACAAATTCGAACACTTTGTGTC...

CDS

Download CDS FASTA

1248 bp · TkA07G020680|TK1151|CDS

ATGTCAAACATGGAGAATCGGAAGCAATCAAGGACATCAGAAGACAGAGATGGTGTCGATATGATCAGTAAATTACCGGATCCTATTCTTCACTTAATTCTTTCACGTCTTCAAAGTACAGAAGAAGTAATTCGAACAAGCATTCTATCATCACGATGGAGACATTTATGGACTTCAGTTCCCTCTATAGACATAGACTATTCCCGAAGACTCAACCCCAATGAAGAATTCGAAAAGAACAAATTCGAACACTTTGTGTC...

Protein

Download Protein FASTA

415 aa · TkA07G020680|TK1151|PROTEIN

MSNMENRKQSRTSEDRDGVDMISKLPDPILHLILSRLQSTEEVIRTSILSSRWRHLWTSVPSIDIDYSRRLNPNEEFEKNKFEHFVSHVLSTNTLDLDTFRLHCTNYYNMSTIKQWIHVAITRKVKLIDLMFCPKDQSDYIEVPDCSSLRVLRLFLLGHAIRVPKLQGFSVLRVLELNSVQIFDGDLVTDLLKRCPLLKDLKLKNLVFSSHIQISCPKLAFLELTGYIGHFKYILKNLDKLKKAVINPNVSVSVSAYELM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G020680`
TK1151 ID	TkA07G020680
OH-1004 ID	LXL04_026954
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 95.796 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G020680

Location Chr07:5584165-5585983 (+)

Description Similar to At3g58880: Putative F-box/LRR-repeat protein At3g58880

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At1g78750`	F-box/FBD/LRR-repeat protein At1g78750.	No verified direct reference in this release
`At5g53640`	Putative FBD-associated F-box protein At5g53640.	No verified direct reference in this release
`At1g78760`	Putative F-box/FBD/LRR-repeat protein At1g78760.	No verified direct reference in this release
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026954 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G66290

ath:AT1G69630

ath:AT1G78750

ath:AT3G58880

ath:AT5G44950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.837

Rank 1 · TkA07G020680 · TK1151

Cytoplasm0.228

Rank 2 · TkA07G020680 · TK1151

Cell membrane0.040

Rank 3 · TkA07G020680 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA07G020680 · TK1151

Plastid0.015

Rank 5 · TkA07G020680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF121-56 aa

PF00646F-box22-61 aa

PF12937F-box-like22-56 aa

PF29132F13C5_N61-111 aa

PF23622LRR_At1g61320_AtMIF193-258 aa

PF12799LRR_4146-154 aa

PF29594LRR_SKP2158-327 aa

PF12799LRR_4163-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G020680	`PF23622`	LRR_At1g61320_AtMIF1	21	56	5.3e-08	33.4
TkA07G020680	`PF00646`	F-box	22	61	2.8e-06	27.7
TkA07G020680	`PF12937`	F-box-like	22	56	0.00018	21.9
TkA07G020680	`PF29132`	F13C5_N	61	111	0.028	15.0
TkA07G020680	`PF23622`	LRR_At1g61320_AtMIF1	93	258	5.3e-08	33.4
TkA07G020680	`PF12799`	LRR_4	146	154	0.32	12.0
TkA07G020680	`PF29594`	LRR_SKP2	158	327	0.0031	17.5
TkA07G020680	`PF12799`	LRR_4	163	180	0.32	12.0
TkA07G020680	`PF12799`	LRR_4	195	205	0.32	12.0
TkA07G020680	`PF08387`	FBD	232	246	0.13	12.9
TkA07G020680	`PF12799`	LRR_4	261	290	0.32	12.0
TkA07G020680	`PF23622`	LRR_At1g61320_AtMIF1	277	400	5.3e-08	33.4
TkA07G020680	`PF00646`	F-box	288	310	2.8e-06	27.7
TkA07G020680	`PF12799`	LRR_4	303	311	0.32	12.0
TkA07G020680	`PF29132`	F13C5_N	310	351	0.028	15.0
TkA07G020680	`PF08387`	FBD	341	378	0.13	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWZ1`	Arabidopsis thaliana	sp\|Q9FWZ1\|FBL13_ARATH F-box/LRR-repeat protein 13	27.700%	Swiss-Prot	Low
`Q9ZV93`	Arabidopsis thaliana	sp\|Q9ZV93\|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750	25.800%	Swiss-Prot	Low
`Q9FJC0`	Arabidopsis thaliana	sp\|Q9FJC0\|FBD20_ARATH Putative FBD-associated F-box protein At5g53640	25.200%	Swiss-Prot	Low
`Q9ZV94`	Arabidopsis thaliana	sp\|Q9ZV94\|FDL11_ARATH Putative F-box/FBD/LRR-repeat protein At1g78760	25.100%	Swiss-Prot	Low
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	25.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card