LXL04_026954 | RubberDandelionOmics

Gene overview

LXL04_026954

Reference: OH-1004 Chr: Chr06 Coordinates: 5854176-5856050 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · LXL04_026954|LXL04_026954|OH1004|cDNA

ATGCTGAAATTGAAAAACTTGTTAATGGCAGAAAAAATTCTGGAGCTTATTTTGTTCATGTCAAACATGGAGAATCGGAAGCAATCAAGGACATCAGAAGACAGAGATGGTGTCGATATGATCAGTAAATTACCGGATCCTATTCTTCACTTAATTCTTTCACGTCTTCAAAGTACAGAAGAAGTAATTCGAACAAGCATTCTATCATCACGATGGAGACATTTATGGACTTCAGTTCCCTCTATAGACATAGACTATTC...

CDS

Download CDS FASTA

1359 bp · LXL04_026954|LXL04_026954|OH1004|CDS

ATGCTGAAATTGAAAAACTTGTTAATGGCAGAAAAAATTCTGGAGCTTATTTTGTTCATGTCAAACATGGAGAATCGGAAGCAATCAAGGACATCAGAAGACAGAGATGGTGTCGATATGATCAGTAAATTACCGGATCCTATTCTTCACTTAATTCTTTCACGTCTTCAAAGTACAGAAGAAGTAATTCGAACAAGCATTCTATCATCACGATGGAGACATTTATGGACTTCAGTTCCCTCTATAGACATAGACTATTC...

Protein

Download Protein FASTA

452 aa · LXL04_026954|LXL04_026954|OH1004|PROTEIN

MLKLKNLLMAEKILELILFMSNMENRKQSRTSEDRDGVDMISKLPDPILHLILSRLQSTEEVIRTSILSSRWRHLWTSVPSIDIDYSRRLNPNEEFEKNKFEHFVSHVLSTNTLDLDTFRLHCTNYYNMSTIKQWIHVAITRKVKLIDLMFCPKDQLDYIEVPDCNSLRVLRLFLLGHAIRVPKLQGFSVLRVLELNSVQIFDGDLVTDLLKRCPLLKDLKLKNLVFSSHIQISCPKLAFLELTGYIGHFKYILKNLDKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026954`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026954

Location Chr06:5854176-5856050 (+)

Description Similar to At3g58880: Putative F-box/LRR-repeat protein At3g58880

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58880`	Putative F-box/LRR-repeat protein At3g58880.	No verified direct reference in this release
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At1g78750`	F-box/FBD/LRR-repeat protein At1g78750.	No verified direct reference in this release
`At5g44950`	Putative F-box/FBD/LRR-repeat protein At5g44950.	No verified direct reference in this release
`At1g66290`	Putative F-box/FBD/LRR-repeat protein At1g66290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026954 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G66290

ath:AT1G69630

ath:AT1G78750

ath:AT3G58880

ath:AT5G44950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.846

Rank 1 · LXL04_026954 · OH-1004

Cytoplasm0.211

Rank 2 · LXL04_026954 · OH-1004

Cell membrane0.038

Rank 3 · LXL04_026954 · OH-1004

Endoplasmic reticulum0.032

Rank 4 · LXL04_026954 · OH-1004

Mitochondrion0.014

Rank 5 · LXL04_026954 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box41-80 aa

PF23622.2LRR_At1g61320_AtMIF1112-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026954	`PF00646.39`	F-box	41	80	3.1e-06	27.6
LXL04_026954	`PF23622.2`	LRR_At1g61320_AtMIF1	112	436	8.6e-08	32.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXR4`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At3g58880	29.426%	Swiss-Prot	weak database homology
`Q9FWZ1`	Arabidopsis thaliana	F-box/LRR-repeat protein 13	29.560%	Swiss-Prot	weak database homology
`Q9ZV93`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At1g78750	28.135%	Swiss-Prot	weak database homology
`Q9FLA2`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At5g44950	32.812%	Swiss-Prot	weak database homology
`Q9C8Y8`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At1g66290	27.419%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card