TkA07G020560 | RubberDandelionOmics

Gene overview

TkA07G020560

Reference: TK1151 Chr: Chr07 Coordinates: 5557746-5560617 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1944 bp · TkA07G020560|TK1151|cDNA

CTACGTGGCACACTTTGCCTCTGCAAACTTTACCTACCATACCGACGAGGCTTATGGAAGCAACGAAGGTCTTCCACCTCTCGAGATCAGTGAATTTTGCTCACAAAATTGAAACACACCAAAAATAACCATTTCCGGATTTCAACTTTCAATCAGTAAAAGGGACATGAAGAAGTCCAAGCAAGTAAATGCATCCGAGCTTGAAGATAGTGTTGATAGGATCAGTAACTTACCCGATCCAATTCTTCACTTGATTCTTT...

CDS

Download CDS FASTA

1377 bp · TkA07G020560|TK1151|CDS

ATGAAGAAGTCCAAGCAAGTAAATGCATCCGAGCTTGAAGATAGTGTTGATAGGATCAGTAACTTACCCGATCCAATTCTTCACTTGATTCTTTCACATCTTCCAACTACAGAAGAAGCAATTCAAACCAGCATTTTGTCAACAAGATGGAGATATCTCTGGACTTCAGTTCACTCTCTACACATAACTGATTACAGATCACGGACTAACCCTCTTATAGAATTCAATAAGAACAAATTCGAAGAGTTTGTATGTCAGGT...

Protein

Download Protein FASTA

458 aa · TkA07G020560|TK1151|PROTEIN

MKKSKQVNASELEDSVDRISNLPDPILHLILSHLPTTEEAIQTSILSTRWRYLWTSVHSLHITDYRSRTNPLIEFNKNKFEEFVCQVLEINSIDLDTVSLSFMQLYKMSTVGRWIDAIVSRKVKLLDLHFSVEDDIDDFKLPHCLVTCESLEVLKFSFGGNCLSFPKFTGFSALRVLELEGCKFLNYDLVHNYLKSLTLLEDLSLIGCRTYDFDTFSISCPNLKNLRIDCREWFYNVYELCDRLEISCPKLVFLEIVGFM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G020560`
TK1151 ID	TkA07G020560
OH-1004 ID	LXL04_026949
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 62.568 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G020560

Location Chr07:5557746-5560617 (+)

Description Similar to At3g26922: F-box/LRR-repeat protein At3g26922

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At1g78750`	F-box/FBD/LRR-repeat protein At1g78750.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g53635`	Putative FBD-associated F-box protein At5g53635.	No verified direct reference in this release
`At5g25850`	Putative F-box/FBD/LRR-repeat protein At5g25850.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026949 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT2G26860

ath:AT3G26922

ath:AT5G44950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.774

Rank 1 · TkA07G020560 · TK1151

Cytoplasm0.335

Rank 2 · TkA07G020560 · TK1151

Endoplasmic reticulum0.039

Rank 3 · TkA07G020560 · TK1151

Cell membrane0.032

Rank 4 · TkA07G020560 · TK1151

Plastid0.017

Rank 5 · TkA07G020560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF114-53 aa

PF00646F-box19-59 aa

PF12937F-box-like19-53 aa

PF25019LRR_R13L1-DRL2156-81 aa

PF23622LRR_At1g61320_AtMIF193-420 aa

PF23598LRR_14103-127 aa

PF24758LRR_At5g56370112-228 aa

PF25019LRR_R13L1-DRL21141-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G020560	`PF23622`	LRR_At1g61320_AtMIF1	14	53	1.7e-08	35.0
TkA07G020560	`PF00646`	F-box	19	59	2.9e-08	34.0
TkA07G020560	`PF12937`	F-box-like	19	53	0.00078	19.9
TkA07G020560	`PF25019`	LRR_R13L1-DRL21	56	81	0.08	13.6
TkA07G020560	`PF23622`	LRR_At1g61320_AtMIF1	93	420	1.7e-08	35.0
TkA07G020560	`PF23598`	LRR_14	103	127	1.4e-06	28.1
TkA07G020560	`PF24758`	LRR_At5g56370	112	228	8.1e-17	62.3
TkA07G020560	`PF25019`	LRR_R13L1-DRL21	141	182	0.08	13.6
TkA07G020560	`PF12799`	LRR_4	150	183	0.00058	20.7
TkA07G020560	`PF23598`	LRR_14	158	369	1.4e-06	28.1
TkA07G020560	`PF24758`	LRR_At5g56370	170	281	8.1e-17	62.3
TkA07G020560	`PF23247`	LRR_RPS2	170	210	0.068	13.9
TkA07G020560	`PF25019`	LRR_R13L1-DRL21	195	228	0.08	13.6
TkA07G020560	`PF12799`	LRR_4	200	229	0.00058	20.7
TkA07G020560	`PF00646`	F-box	217	226	2.9e-08	34.0
TkA07G020560	`PF25019`	LRR_R13L1-DRL21	221	277	0.08	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	26.700%	Swiss-Prot	Low
`Q9ZV93`	Arabidopsis thaliana	sp\|Q9ZV93\|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750	25.300%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	32.500%	Swiss-Prot	Medium
`Q9FJC1`	Arabidopsis thaliana	sp\|Q9FJC1\|FBD31_ARATH Putative FBD-associated F-box protein At5g53635	25.400%	Swiss-Prot	Low
`Q3E944`	Arabidopsis thaliana	sp\|Q3E944\|FDL33_ARATH Putative F-box/FBD/LRR-repeat protein At5g25850	24.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card