TkA07G013860 | RubberDandelionOmics

Gene overview

TkA07G013860

Reference: TK1151 Chr: Chr07 Coordinates: 3778747-3779334 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA07G013860|TK1151|cDNA

ATGTTTGATCATGCCTCCAAGGTGTTCGACGAAATGCCCGAGAGAAATTGCCCGCAGACTATCAAGTCGTTCAATGCACTTCTCGGGGCGTGTGTTAACGCAAAGAAGTTCGATAAGCTTGAAGGGTTTTTCCGGGAGTTGCCTGAGAAGCTATCATTGAAACCTGATATCGTCTCGTATAACACCGCGATCAAAGCTTTCTGCGATATGGGTTCGTTTGATTCAGCTGCGACTCTATTTGATGAAATCGAAAAGAACGG...

CDS

Download CDS FASTA

588 bp · TkA07G013860|TK1151|CDS

ATGTTTGATCATGCCTCCAAGGTGTTCGACGAAATGCCCGAGAGAAATTGCCCGCAGACTATCAAGTCGTTCAATGCACTTCTCGGGGCGTGTGTTAACGCAAAGAAGTTCGATAAGCTTGAAGGGTTTTTCCGGGAGTTGCCTGAGAAGCTATCATTGAAACCTGATATCGTCTCGTATAACACCGCGATCAAAGCTTTCTGCGATATGGGTTCGTTTGATTCAGCTGCGACTCTATTTGATGAAATCGAAAAGAACGG...

Protein

Download Protein FASTA

195 aa · TkA07G013860|TK1151|PROTEIN

MFDHASKVFDEMPERNCPQTIKSFNALLGACVNAKKFDKLEGFFRELPEKLSLKPDIVSYNTAIKAFCDMGSFDSAATLFDEIEKNGMEPDLITFNTLLIGCYGNGRFLDGEKFWAKMMNTNLSPDIRTYNAKLVGLVSEKKLDEAIDIFNKLASKNLKPDEFSYNAIITGFCNNGDLTEAKNWYAKTRAKRFHY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G013860`
TK1151 ID	TkA07G013860
OH-1004 ID	LXL04_027158
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 44.615 / OH-1004 23.138 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G013860

Location Chr07:3778747-3779334 (+)

Description Similar to At1g55890: Pentatricopeptide repeat-containing protein At1g55890, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13160`	Small ribosomal subunit protein mS79 (rPPR3b).	No verified direct reference in this release
`At3g13150`	Pentatricopeptide repeat-containing protein At3g13150.	No verified direct reference in this release
`At1g55890`	Small ribosomal subunit protein mS78 (rPPR3a).	No verified direct reference in this release
`At1g80150`	Pentatricopeptide repeat-containing protein At1g80150, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027158 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G55890

ath:AT2G18520

ath:AT3G13150

ath:AT3G13160

ath:AT4G36680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.831

Rank 1 · TkA07G013860 · TK1151

Plastid0.092

Rank 2 · TkA07G013860 · TK1151

Nucleus0.042

Rank 3 · TkA07G013860 · TK1151

Cytoplasm0.030

Rank 4 · TkA07G013860 · TK1151

Cell membrane0.010

Rank 5 · TkA07G013860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535PPR1-17 aa

PF13041PPR_22-33 aa

PF29070MSC6_N2-81 aa

PF29978ATP18_TPR2-34 aa

PF12854PPR_13-12 aa

PF23276TPR_243-45 aa

PF13812PPR_34-33 aa

PF17177PPR_long4-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G013860	`PF01535`	PPR	1	17	5.5e-28	95.9
TkA07G013860	`PF13041`	PPR_2	2	33	1.5e-45	153.8
TkA07G013860	`PF29070`	MSC6_N	2	81	4.5e-12	46.5
TkA07G013860	`PF29978`	ATP18_TPR	2	34	6.7e-07	30.0
TkA07G013860	`PF12854`	PPR_1	3	12	1.2e-28	99.3
TkA07G013860	`PF23276`	TPR_24	3	45	4.5e-07	30.5
TkA07G013860	`PF13812`	PPR_3	4	33	1.7e-25	89.6
TkA07G013860	`PF17177`	PPR_long	4	104	9.8e-12	45.4
TkA07G013860	`PF25100`	DUF7809	10	64	0.0024	18.9
TkA07G013860	`PF13041`	PPR_2	21	49	1.5e-45	153.8
TkA07G013860	`PF01535`	PPR	23	49	5.5e-28	95.9
TkA07G013860	`PF28722`	WHD_Sfc3_5th	50	87	0.14	13.1
TkA07G013860	`PF13812`	PPR_3	51	105	1.7e-25	89.6
TkA07G013860	`PF12854`	PPR_1	53	83	1.2e-28	99.3
TkA07G013860	`PF29978`	ATP18_TPR	54	73	6.7e-07	30.0
TkA07G013860	`PF13041`	PPR_2	55	102	1.5e-45	153.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK57`	Arabidopsis thaliana	sp\|Q9LK57\|PP226_ARATH Small ribosomal subunit protein mS79 (rPPR3b)	65.500%	Swiss-Prot	Low
`Q9LK58`	Arabidopsis thaliana	sp\|Q9LK58\|PP225_ARATH Pentatricopeptide repeat-containing protein At3g13150	58.300%	Swiss-Prot	Low
`Q9LG23`	Arabidopsis thaliana	sp\|Q9LG23\|PPR82_ARATH Small ribosomal subunit protein mS78 (rPPR3a)	58.600%	Swiss-Prot	Low
`Q8GW57`	Arabidopsis thaliana	sp\|Q8GW57\|PP134_ARATH Pentatricopeptide repeat-containing protein At1g80150, mitochondrial	34.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card