RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G471110
Reference: TK1151 Chr: Chr06 Coordinates: 116522994-116526781 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2966 bp · TkA06G471110|TK1151|cDNA

CCCACACAGAGTCCCACGTGTGTGGTTGCCACGTGCACGTGAACTGCACGTGCTGTCCACTGATTGGGTTTGTACTAATTCCCATTTCTCCCAACTTGAATGAGTAATTATATGATAAGAGAAGGGTGGCCTACTCTCTCTGTCTCTCTCTTTACTGTCACACAAGACAAAAGTCTTTGATGAAACCATGACAATGATAGGAAGGAGAGAGAACGGGGAATTTACACACAGTGAGTTTCCTTGTGTGTGTTTAAAAGTTA...

CDS

Download CDS FASTA

1560 bp · TkA06G471110|TK1151|CDS

ATGTTTGATGGAGTCCCAGTTGAGCAATTTCGCCAATTTATCTCCACACCCTCCTCAAGAATCCCTTCAAATAATTCGACTTTAATTCAAACCCCACCAATTTCGACTTCAACAAACCTAAATTTTCTATCTTTTGATCCTCTCTTATTCACTCCCAATCTTCCTACTCCTCATCACCATCAATCGCTATTTCAATCCCAGCATTTTCTGCGAACATCCCCACGAGATCATTACAATGTCACTGAAGGCAAAGTAGATCA...

Protein

Download Protein FASTA

519 aa · TkA06G471110|TK1151|PROTEIN

MFDGVPVEQFRQFISTPSSRIPSNNSTLIQTPPISTSTNLNFLSFDPLLFTPNLPTPHHHQSLFQSQHFLRTSPRDHYNVTEGKVDQEIDISDSWSNDEVIQLLRIKSSSENWFKDLTWDHVSRKLSELGYKRSAQKCKEKFEEETCRSFSSTIGYNKNSSRYMISEELDENLYNNADQNTHHHVTTESPEDMSYQEKLQVDEKEEEQQQDLEVQGQKGHFEEDASEIMIQRSEDNVHVTNSKKRKRKHKKFKMVKGLCV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G471110
TK1151 IDTkA06G471110
OH-1004 IDLXL04_022629
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.400
Protein coverage (%)TK1151 98.073 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G471110
LocationChr06:116522994-116526781 (-)
DescriptionSimilar to At5g28300: Trihelix transcription factor GTL2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g28300 Probable transcription factor that binds specific DNA sequence. No verified direct reference in this release
At1g76890 Probable transcription factor that binds specific DNA sequence. No verified direct reference in this release
At1g76880 Transcription repressor that negatively regulates root hair growth by directly binding RSL4 promoter and repressing RSL4 expression. No verified direct reference in this release
At1g33240 Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter.
The trihelix transcription factor GTL1 regulates ploidy-dependent cell growth in the Arabidopsis trichome.2009 · DOI: 10.1105/tpc.109.068387
The Arabidopsis GTL1 transcription factor regulates water use efficiency and drought tolerance by modulating stomatal density via transrepression of SDD1.2010 · DOI: 10.1105/tpc.110.078691
GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.2018 · DOI: 10.1242/dev.159707
At5g03680 Transcription factor that prevents growth. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022629 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0019760 glucosinolate metabolic process Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process
GO:0048358 mucilage pectin biosynthetic process Biological Process
GO:0048768 root hair cell tip growth Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
KEGG gene cross-reference
ath:AT1G76880
ath:AT1G76890
ath:AT5G28300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979
Rank 1 · TkA06G471110 · TK1151
Cytoplasm0.070
Rank 2 · TkA06G471110 · TK1151
Cell membrane0.021
Rank 3 · TkA06G471110 · TK1151
Endoplasmic reticulum0.012
Rank 4 · TkA06G471110 · TK1151
Plastid0.010
Rank 5 · TkA06G471110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_493-164 aa
PF13921Myb_DNA-bind_695-150 aa
PF10545MADF_DNA_bdg114-143 aa
PF23627LisH_WDR26126-136 aa
PF13837Myb_DNA-bind_4244-256 aa
PF10545MADF_DNA_bdg277-322 aa
PF23627LisH_WDR26285-293 aa
PF13921Myb_DNA-bind_6289-302 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G471110PF13837Myb_DNA-bind_4931641.1e-28100.2
TkA06G471110PF13921Myb_DNA-bind_6951500.005217.6
TkA06G471110PF10545MADF_DNA_bdg1141430.0003821.4
TkA06G471110PF23627LisH_WDR261261360.510.5
TkA06G471110PF13837Myb_DNA-bind_42442561.1e-28100.2
TkA06G471110PF10545MADF_DNA_bdg2773220.0003821.4
TkA06G471110PF23627LisH_WDR262852930.510.5
TkA06G471110PF13921Myb_DNA-bind_62893020.005217.6
TkA06G471110PF13837Myb_DNA-bind_43894891.1e-28100.2
TkA06G471110PF10545MADF_DNA_bdg4324870.0003821.4
TkA06G471110PF13921Myb_DNA-bind_64324680.005217.6
TkA06G471110PF23627LisH_WDR264364500.510.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8H181Arabidopsis thalianasp|Q8H181|GTL2_ARATH Trihelix transcription factor GTL238.200%Swiss-ProtMedium
Q39117Arabidopsis thalianasp|Q39117|TGT2_ARATH Trihelix transcription factor GT-241.600%Swiss-ProtLow
Q9C6K3Arabidopsis thalianasp|Q9C6K3|DF1_ARATH Trihelix transcription factor DF130.800%Swiss-ProtLow
Q9C882Arabidopsis thalianasp|Q9C882|GTL1_ARATH Trihelix transcription factor GTL152.500%Swiss-ProtLow
Q9LZS0Arabidopsis thalianasp|Q9LZS0|PTL_ARATH Trihelix transcription factor PTL40.200%Swiss-ProtLow

JBrowse

View in Genome Browser