LXL04_022629 | RubberDandelionOmics

Gene overview

LXL04_022629

Reference: OH-1004 Chr: Chr05 Coordinates: 3447685-3450263 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · LXL04_022629|LXL04_022629|OH1004|cDNA

ATGTTTGATGGAGTCCCAGTTGAGCAATTTCGCCAATTTATCTCCACACCCTCCTCAAGAATCCCTTCAAATAATTCGACTTTAATTCAAACCCCACCAATTTCGACTTCAACAAACCTAAATTTTCTATCTTTTGATCCTCTTTTGTTTACTCCAAATCTTCCTACTCCTCATCACCATCAATCGCTATTTCAATCCCAGCATTTTCTGCGAACATCCCCACGAGATCATTACAATGTCACTGAAGGCAAAGTAGATCA...

CDS

Download CDS FASTA

1524 bp · LXL04_022629|LXL04_022629|OH1004|CDS

ATGTTTGATGGAGTCCCAGTTGAGCAATTTCGCCAATTTATCTCCACACCCTCCTCAAGAATCCCTTCAAATAATTCGACTTTAATTCAAACCCCACCAATTTCGACTTCAACAAACCTAAATTTTCTATCTTTTGATCCTCTTTTGTTTACTCCAAATCTTCCTACTCCTCATCACCATCAATCGCTATTTCAATCCCAGCATTTTCTGCGAACATCCCCACGAGATCATTACAATGTCACTGAAGGCAAAGTAGATCA...

Protein

Download Protein FASTA

507 aa · LXL04_022629|LXL04_022629|OH1004|PROTEIN

MFDGVPVEQFRQFISTPSSRIPSNNSTLIQTPPISTSTNLNFLSFDPLLFTPNLPTPHHHQSLFQSQHFLRTSPRDHYNVTEGKVDQEIDISDSWSNDEVIQLLRIKSSSENWFKDLTWDHVSRKLSELGYKRSAQKCKEKFEEETCRNFSSTIGYNKNSSRYMISEELDENLYNNADQNTHHHVTTESPEDMSYQEKPQVDEKEEEQQQDLEVQGQKGHFEEDASEIMIQRSEDNVHVTNSKKRKRKHKKFKMVKGLCV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022629`
TK1151 ID	TkA06G471110
OH-1004 ID	LXL04_022629
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 98.073 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022629

Location Chr05:3447685-3450263 (+)

Description Similar to At5g28300: Trihelix transcription factor GTL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28300`	Probable transcription factor that binds specific DNA sequence.	No verified direct reference in this release
`At1g76890`	Probable transcription factor that binds specific DNA sequence.	No verified direct reference in this release
`At1g76880`	Transcription repressor that negatively regulates root hair growth by directly binding RSL4 promoter and repressing RSL4 expression.	No verified direct reference in this release
`At1g33240`	Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter.	The trihelix transcription factor GTL1 regulates ploidy-dependent cell growth in the Arabidopsis trichome.2009 · DOI: 10.1105/tpc.109.068387 The Arabidopsis GTL1 transcription factor regulates water use efficiency and drought tolerance by modulating stomatal density via transrepression of SDD1.2010 · DOI: 10.1105/tpc.110.078691 GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.2018 · DOI: 10.1242/dev.159707
`At5g03680`	Transcription factor that prevents growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022629 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G76880

ath:AT1G76890

ath:AT5G28300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · LXL04_022629 · OH-1004

Cytoplasm0.071

Rank 2 · LXL04_022629 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_022629 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_022629 · OH-1004

Plastid0.010

Rank 5 · LXL04_022629 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837.13Myb_DNA-bind_493-163 aa

PF13837.13Myb_DNA-bind_4389-487 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022629	`PF13837.13`	Myb_DNA-bind_4	93	163	8.6e-29	100.5
LXL04_022629	`PF13837.13`	Myb_DNA-bind_4	389	487	8.6e-29	100.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H181`	Arabidopsis thaliana	Trihelix transcription factor GTL2	38.972%	Swiss-Prot	moderate database homology
`Q39117`	Arabidopsis thaliana	Trihelix transcription factor GT-2	39.855%	Swiss-Prot	moderate database homology
`Q9C6K3`	Arabidopsis thaliana	Trihelix transcription factor DF1	32.800%	Swiss-Prot	weak database homology
`Q9C882`	Arabidopsis thaliana	Trihelix transcription factor GTL1	53.535%	Swiss-Prot	weak database homology
`Q9LZS0`	Arabidopsis thaliana	Trihelix transcription factor PTL	26.914%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card