RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G469120
Reference: TK1151 Chr: Chr06 Coordinates: 116017930-116028119 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

696 bp · TkA06G469120|TK1151|cDNA

ATTTCAGTTCAATCACTTTCCTTTTTCATATTAATTCTGATACTATACTCATATCAACATCAATGAGTATCTATATGATATTTGAAAAAACAGGCATCATCAAATGTATTATATATGCATTTTTGTTCTGTGGTCCCACCAAGATATTATGATATGGATATTTCGGTTTTTGGGGGTCTCTGATCCAGTCGAACACCACCATCATGAACATCAGAAACAATCGGAAATCACTCCTTTTTCGCCAGTGTTGACTCGTGAAT...

CDS

Download CDS FASTA

450 bp · TkA06G469120|TK1151|CDS

ATGTATTATATATGCATTTTTGTTCTGTGGTCCCACCAAGATATTATGATATGGATATTTCGGTTTTTGGGGGTCTCTGATCCAGTCGAACACCACCATCATGAACATCAGAAACAATCGGAAATCACTCCTTTTTCGCCAGTGTTGACTCGTGAATTTCTTGAGGTCAAAAACTTCAAGGACATCCAGGAGAAAGAGTTACCCGAAAGTTGTGCAGTGTGCTTGGATGTGTTTCATGAAGATGACGAGATTAGATGTTT...

Protein

Download Protein FASTA

149 aa · TkA06G469120|TK1151|PROTEIN

MYYICIFVLWSHQDIMIWIFRFLGVSDPVEHHHHEHQKQSEITPFSPVLTREFLEVKNFKDIQEKELPESCAVCLDVFHEDDEIRCLTNCKHIFHKCCLDSWMDQLQGTCPMCRTPILPVECEDEYKTHLNVAAEHHYLFDEVLRIPDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G469120
TK1151 IDTkA06G469120
OH-1004 IDLXL04_017302
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)57.200
Protein coverage (%)TK1151 92.617 / OH-1004 68.844
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G469120
LocationChr06:116017930-116028119 (+)
DescriptionSimilar to BRH1: Brassinosteroid-responsive RING protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g61460 May be involved in the brassinosteroids (BRs) signaling pathway and regulate the growth and development of rosette leaves.
Characterisation of BRH1, a brassinosteroid-responsive RING-H2 gene from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-001-0723-z
Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.2018 · DOI: 10.1007/s11427-017-9133-8
At2g04240 Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.
Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x
Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999
At2g01150 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development.
The Arabidopsis RING finger E3 ligase RHA2b acts additively with RHA2a in regulating abscisic acid signaling and drought response.2011 · DOI: 10.1104/pp.111.176214
At1g15100 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development.
The Arabidopsis RING finger E3 ligase RHA2a is a novel positive regulator of abscisic acid signaling during seed germination and early seedling development.2009 · DOI: 10.1104/pp.109.135269
The Arabidopsis RING finger E3 ligase RHA2b acts additively with RHA2a in regulating abscisic acid signaling and drought response.2011 · DOI: 10.1104/pp.111.176214
At1g22500 E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8, UBC10, UBC11, UBC28 and UBC29 in vitro. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017302 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000209 protein polyubiquitination Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0010200 response to chitin Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0031669 cellular response to nutrient levels Biological Process
GO:0032418 lysosome localization Biological Process
GO:0034198 cellular response to amino acid starvation Biological Process
GO:0035519 protein K29-linked ubiquitination Biological Process
GO:0045786 negative regulation of cell cycle Biological Process
GO:0051640 organelle localization Biological Process
KEGG gene cross-reference
ath:AT3G61460
ath:AT4G11360
ath:AT4G11370
hsa:26001
mmu:70510
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.387
Rank 1 · TkA06G469120 · TK1151
Endoplasmic reticulum0.251
Rank 2 · TkA06G469120 · TK1151
Nucleus0.238
Rank 3 · TkA06G469120 · TK1151
Golgi apparatus0.169
Rank 4 · TkA06G469120 · TK1151
Lysosome / Vacuole0.153
Rank 5 · TkA06G469120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15227zf-C3HC4_45-14 aa
PF23555zf-RING_Vps4145-60 aa
PF13920zf-C3HC4_369-117 aa
PF17120zf-RING_1669-81 aa
PF17120zf-RING_1669-112 aa
PF13639zf-RING_270-114 aa
PF14835zf-RING_670-117 aa
PF27108PHD_Pygo70-99 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G469120PF15227zf-C3HC4_45142.78.9
TkA06G469120PF23555zf-RING_Vps4145600.05713.8
TkA06G469120PF13920zf-C3HC4_3691170.008716.6
TkA06G469120PF17120zf-RING_1669810.01116.1
TkA06G469120PF17120zf-RING_16691120.01116.1
TkA06G469120PF13639zf-RING_2701141.8e-1041.6
TkA06G469120PF14835zf-RING_6701170.001619.0
TkA06G469120PF27108PHD_Pygo70990.05914.2
TkA06G469120PF14446Prok-RING_170998.87.3
TkA06G469120PF14634zf-RING_5711159.9e-0626.2
TkA06G469120PF17123zf-RING_1171992.5e-0524.6
TkA06G469120PF00097zf-C3HC4711135e-0523.8
TkA06G469120PF13923zf-C3HC4_2711137.9e-0523.1
TkA06G469120PF13445zf-RING_UBOX711110.0005920.5
TkA06G469120PF23555zf-RING_Vps41711050.05713.8
TkA06G469120PF15227zf-C3HC4_4711132.78.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9XF92Arabidopsis thalianasp|Q9XF92|BRH1_ARATH Brassinosteroid-responsive RING protein 143.300%Swiss-ProtMedium
Q9SI09Arabidopsis thalianasp|Q9SI09|XERIC_ARATH Probable E3 ubiquitin-protein ligase XERICO48.200%Swiss-ProtLow
Q9ZU51Arabidopsis thalianasp|Q9ZU51|RHA2B_ARATH E3 ubiquitin-protein ligase RHA2B46.900%Swiss-ProtLow
Q9ZT50Arabidopsis thalianasp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A44.200%Swiss-ProtLow
Q9SK92Arabidopsis thalianasp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL1543.400%Swiss-ProtLow

JBrowse

View in Genome Browser