LXL04_017302 | RubberDandelionOmics

Gene overview

LXL04_017302

Reference: OH-1004 Chr: Chr03 Coordinates: 145933945-145936363 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

600 bp · LXL04_017302|LXL04_017302|OH1004|cDNA

ATGGATGTGTATATGGCTTTAAAAGAAACGGGCCTTTCCAAATACATCATGTatttatgttttgttttatGTTCCATTCAAAACATTGTGTTGTTTCTTTTTCGTTTCACTGGCATCTTTGAGTCCGATGAGTCCCACAATCACGATCACGAAAAACAATCTGAAGGTCCTCCTCATTCAGGAGTGTTAACTCGACAATTCCTTGAGGTCACGGACTTTAAGGACATCCAGAGGAAGGATTTGCCAGAAAGTTGTGCAAT...

CDS

Download CDS FASTA

600 bp · LXL04_017302|LXL04_017302|OH1004|CDS

ATGGATGTGTATATGGCTTTAAAAGAAACGGGCCTTTCCAAATACATCATGTATTTATGTTTTGTTTTATGTTCCATTCAAAACATTGTGTTGTTTCTTTTTCGTTTCACTGGCATCTTTGAGTCCGATGAGTCCCACAATCACGATCACGAAAAACAATCTGAAGGTCCTCCTCATTCAGGAGTGTTAACTCGACAATTCCTTGAGGTCACGGACTTTAAGGACATCCAGAGGAAGGATTTGCCAGAAAGTTGTGCAAT...

Protein

Download Protein FASTA

199 aa · LXL04_017302|LXL04_017302|OH1004|PROTEIN

MDVYMALKETGLSKYIMYLCFVLCSIQNIVLFLFRFTGIFESDESHNHDHEKQSEGPPHSGVLTRQFLEVTDFKDIQRKDLPESCAICLDEFGRDDKTRCLKNCIHIFHQSCLDHWMDHVHETCPICRTPILPHVYQDEYEKRFKVANSRHNFYIWTSSVTDQHRRFKTNESIANFLLHLFTTAELIHRSIADFLPITP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017302`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017302

Location Chr03:145933945-145936363 (-)

Description Similar to BRH1: Brassinosteroid-responsive RING protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61460`	May be involved in the brassinosteroids (BRs) signaling pathway and regulate the growth and development of rosette leaves.	Characterisation of BRH1, a brassinosteroid-responsive RING-H2 gene from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-001-0723-z Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.2018 · DOI: 10.1007/s11427-017-9133-8
`At4g11360`	Possesses E3 ubiquitin-protein ligase activity when associated with the E2 enzyme UBC8 in vitro.	No verified direct reference in this release
`At4g11370`	Probable E3 ubiquitin-protein ligase that may possess E3 ubiquitin ligase activity in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017302 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010200 response to chitin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

GO:0032418 lysosome localization Biological Process

GO:0034198 cellular response to amino acid starvation Biological Process

GO:0035519 protein K29-linked ubiquitination Biological Process

GO:0045786 negative regulation of cell cycle Biological Process

GO:0051640 organelle localization Biological Process

KEGG gene cross-reference

ath:AT3G61460

ath:AT4G11360

ath:AT4G11370

hsa:26001

mmu:70510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.308

Rank 1 · LXL04_017302 · OH-1004

Cytoplasm0.274

Rank 2 · LXL04_017302 · OH-1004

Nucleus0.211

Rank 3 · LXL04_017302 · OH-1004

Cell membrane0.202

Rank 4 · LXL04_017302 · OH-1004

Lysosome / Vacuole0.185

Rank 5 · LXL04_017302 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_284-128 aa

PF17123.12zf-RING_1185-113 aa

PF14634.13zf-RING_585-129 aa

PF13923.13zf-C3HC4_285-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017302	`PF13639.13`	zf-RING_2	84	128	1.2e-11	45.4
LXL04_017302	`PF17123.12`	zf-RING_11	85	113	5.2e-07	30.0
LXL04_017302	`PF14634.13`	zf-RING_5	85	129	4.5e-06	27.3
LXL04_017302	`PF13923.13`	zf-C3HC4_2	85	127	5.9e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XF92`	Arabidopsis thaliana	Brassinosteroid-responsive RING protein 1	38.037%	Swiss-Prot	moderate database homology
`Q9SUS5`	Arabidopsis thaliana	E3 ubiquitin-protein ligase RHA1B	30.496%	Swiss-Prot	moderate database homology
`Q9SUS4`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase RHA1A	30.534%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card