TkA06G457000 | RubberDandelionOmics

Gene overview

TkA06G457000

Reference: TK1151 Chr: Chr06 Coordinates: 112965615-112966097 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA06G457000|TK1151|cDNA

ATGGATAATCCCCGAAATAACAAAGTGTTGGTGATAGCGGCTACCGACATTCCGCAGATTCTTGACCCTGCGATAAAGAGGCGCAGGAGATTTGAGCTCGAAGATAATATCGATTTGATATCGATTTCAAAGATGACTCAAGGTTTTTGTGTTGGTGATCTAAAAGGCCTTATTAATCAAGCTGCTGGATTTGTAACTGATAGGATGTTCGATGACCGAAAGTTGAAATATGTAGATTGGCGTACCAAGCCGTTCAGCGA...

CDS

Download CDS FASTA

408 bp · TkA06G457000|TK1151|CDS

ATGGATAATCCCCGAAATAACAAAGTGTTGGTGATAGCGGCTACCGACATTCCGCAGATTCTTGACCCTGCGATAAAGAGGCGCAGGAGATTTGAGCTCGAAGATAATATCGATTTGATATCGATTTCAAAGATGACTCAAGGTTTTTGTGTTGGTGATCTAAAAGGCCTTATTAATCAAGCTGCTGGATTTGTAACTGATAGGATGTTCGATGACCGAAAGTTGAAATATGTAGATTGGCGTACCAAGCCGTTCAGCGA...

Protein

Download Protein FASTA

135 aa · TkA06G457000|TK1151|PROTEIN

MDNPRNNKVLVIAATDIPQILDPAIKRRRRFELEDNIDLISISKMTQGFCVGDLKGLINQAAGFVTDRMFDDRKLKYVDWRTKPFSDEEMKPYRITTLDLEMAVKQMQSSFPHLRFFNVFFCIGFLPAYIQLFHN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G457000`
TK1151 ID	TkA06G457000
OH-1004 ID	LXL04_022732
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.000
Protein coverage (%)	TK1151 100.000 / OH-1004 61.468 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G457000`
Location	Chr06:112965615-112966097 (+)
Description	Similar to CDC48C: Cell division control protein 48 homolog C
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022732` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006274 DNA replication termination Biological Process GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process GO:0010564 regulation of cell cycle process Biological Process GO:0010636 positive regulation of mitochondrial fusion Biological Process GO:0015031 protein transport Biological Process GO:0016236 macroautophagy Biological Process GO:0016320 endoplasmic reticulum membrane fusion Biological Process GO:0030970 retrograde protein transport, ER to cytosol Biological Process GO:0031134 sister chromatid biorientation Biological Process GO:0032984 protein-containing complex disassembly Biological Process GO:0034517 ribophagy Biological Process GO:0034727 piecemeal microautophagy of the nucleus Biological Process
KEGG gene cross-reference	ath:AT3G01610 pfa:PF3D7_0711000 sce:YDL126C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.470

Rank 1 · TkA06G457000 · TK1151

Nucleus0.322

Rank 2 · TkA06G457000 · TK1151

Mitochondrion0.129

Rank 3 · TkA06G457000 · TK1151

Peroxisome0.105

Rank 4 · TkA06G457000 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA06G457000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004AAA1-36 aa

PF17862AAA_lid_336-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G457000	`PF00004`	AAA	1	36	0.0011	20.1
TkA06G457000	`PF17862`	AAA_lid_3	36	62	0.12	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card