TkA06G451910 | RubberDandelionOmics

Gene overview

TkA06G451910

Reference: TK1151 Chr: Chr06 Coordinates: 111649225-111651312 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

964 bp · TkA06G451910|TK1151|cDNA

GTGATTAAGGCAAATGCACAGCAGCCAAAGCTTTTTATTGGAATGATTTTGATCCTTATTTTTGCTGAAGCACTTGCATTATACTACTCATTTCAAGACACTGCATAGTAAAATTATACTACTCATTTCAAGACACTGAATATTTGTACCTGATAATGGAATATCTTCCTGGTGGTGACATGATGACTTTGTTAATGAGAGGAGACACATTAAAAGAAAATGTTGCAAAGTTTTACATAGCTCAAAGTGTCATGGCCATA...

CDS

Download CDS FASTA

528 bp · TkA06G451910|TK1151|CDS

ATGGAATATCTTCCTGGTGGTGACATGATGACTTTGTTAATGAGAGGAGACACATTAAAAGAAAATGTTGCAAAGTTTTACATAGCTCAAAGTGTCATGGCCATAGAGTCCATTCACAAACATAACTACATTAATAGATATATAAAACCAGACAACCTTCTTCTAGACAAAAACGGTCACATGAAGCTTTCAGATTTTGGGCTGTGTAAGCCTCTTGATTGTAGGACATTGTCCACATTGAATGAAAATGAAGCCATGAG...

Protein

Download Protein FASTA

175 aa · TkA06G451910|TK1151|PROTEIN

MEYLPGGDMMTLLMRGDTLKENVAKFYIAQSVMAIESIHKHNYINRYIKPDNLLLDKNGHMKLSDFGLCKPLDCRTLSTLNENEAMSDENIREPMEIDGFPDAVNGHRWKSAHEQLQHWQMNRRKLAFSTVGIPDYIAPELLLKKGYGMECDWWSLGEIMYEMLVDILHFTQMIQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G451910`
TK1151 ID	TkA06G451910
OH-1004 ID	LXL04_003117
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.200
Protein coverage (%)	TK1151 94.286 / OH-1004 32.046 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G451910`
Location	Chr06:111649225-111651312 (+)
Description	Similar to CBK1: Serine/threonine-protein kinase CBK1 (Candida albicans (strain SC5314 / ATCC MYA-2876)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003117` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000077 DNA damage checkpoint signaling Biological Process GO:0000902 cell morphogenesis Biological Process GO:0000920 septum digestion after cytokinesis Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006974 DNA damage response Biological Process GO:0007118 budding cell apical bud growth Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0009267 cellular response to starvation Biological Process GO:0030447 filamentous growth Biological Process GO:0030866 cortical actin cytoskeleton organization Biological Process GO:0030950 establishment or maintenance of actin cytoskeleton polarity Biological Process
KEGG gene cross-reference	bta:533677 cal:CAALFM_C110380CA hsa:11329 pon:100173048 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.569

Rank 1 · TkA06G451910 · TK1151

Nucleus0.439

Rank 2 · TkA06G451910 · TK1151

Mitochondrion0.077

Rank 3 · TkA06G451910 · TK1151

Cell membrane0.067

Rank 4 · TkA06G451910 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA06G451910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase1-74 aa

PF07714PK_Tyr_Ser-Thr1-75 aa

PF03109ABC11-78 aa

PF10140YukC20-68 aa

PF14531Kinase-like21-67 aa

PF00069Pkinase121-171 aa

PF07714PK_Tyr_Ser-Thr135-164 aa

PF14531Kinase-like150-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G451910	`PF00069`	Pkinase	1	74	2.9e-28	99.7
TkA06G451910	`PF07714`	PK_Tyr_Ser-Thr	1	75	9.6e-13	48.7
TkA06G451910	`PF03109`	ABC1	1	78	0.007	16.3
TkA06G451910	`PF10140`	YukC	20	68	0.11	12.0
TkA06G451910	`PF14531`	Kinase-like	21	67	0.16	11.9
TkA06G451910	`PF00069`	Pkinase	121	171	2.9e-28	99.7
TkA06G451910	`PF07714`	PK_Tyr_Ser-Thr	135	164	9.6e-13	48.7
TkA06G451910	`PF14531`	Kinase-like	150	164	0.16	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card