LXL04_003117 | RubberDandelionOmics

Gene overview

LXL04_003117

Reference: OH-1004 Chr: Chr01 Coordinates: 68450362-68453315 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1557 bp · LXL04_003117|LXL04_003117|OH1004|cDNA

ATGGAGGAGGGAGTGCAAGGAGGAGACGATGAAATTCTGGGGTCAAGCTTGACCATGGAGAAAGTGGCTGCTGCTAAGCAATTCATAGAGAATCACTACAAAACTCAGATGAAGAACATTCAGGAACGCAAAGAAAGGCGATGGATCTTAGAGAGGAAGTTGGCTTCTTCAGATGTACCTAAAGAAGAACAGATTAATCTGATCAAGGATTTAGAGAGAAAGGAAACAGAGTTTATGCGACTTAAAAGGAACAAAATATG...

CDS

Download CDS FASTA

1557 bp · LXL04_003117|LXL04_003117|OH1004|CDS

ATGGAGGAGGGAGTGCAAGGAGGAGACGATGAAATTCTGGGGTCAAGCTTGACCATGGAGAAAGTGGCTGCTGCTAAGCAATTCATAGAGAATCACTACAAAACTCAGATGAAGAACATTCAGGAACGCAAAGAAAGGCGATGGATCTTAGAGAGGAAGTTGGCTTCTTCAGATGTACCTAAAGAAGAACAGATTAATCTGATCAAGGATTTAGAGAGAAAGGAAACAGAGTTTATGCGACTTAAAAGGAACAAAATATG...

Protein

Download Protein FASTA

518 aa · LXL04_003117|LXL04_003117|OH1004|PROTEIN

MEEGVQGGDDEILGSSLTMEKVAAAKQFIENHYKTQMKNIQERKERRWILERKLASSDVPKEEQINLIKDLERKETEFMRLKRNKICVDDFELLTIIGRGAFGEVRLCREKKSGNIYAMKKLKKSEMLVRGQVEHVRAERNLLAEVASHCIVKLYYSFQDTEYLYLIMEYLPGGDMMTLLMREDTLKENVAKFYIAQSVMAIESIHKHNYIHRDIKPDNLLLDKNGHMKLSDFGLCKPLDCRTLSTLNENEAMSDENIRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003117`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_003117`
Location	Chr01:68450362-68453315 (-)
Description	Similar to CBK1: Serine/threonine-protein kinase CBK1 (Candida albicans (strain SC5314 / ATCC MYA-2876)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003117` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000077 DNA damage checkpoint signaling Biological Process GO:0000902 cell morphogenesis Biological Process GO:0000920 septum digestion after cytokinesis Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006974 DNA damage response Biological Process GO:0007118 budding cell apical bud growth Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0009267 cellular response to starvation Biological Process GO:0030447 filamentous growth Biological Process GO:0030866 cortical actin cytoskeleton organization Biological Process GO:0030950 establishment or maintenance of actin cytoskeleton polarity Biological Process
KEGG gene cross-reference	bta:533677 cal:CAALFM_C110380CA hsa:11329 pon:100173048 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.583

Rank 1 · LXL04_003117 · OH-1004

Nucleus0.514

Rank 2 · LXL04_003117 · OH-1004

Cell membrane0.109

Rank 3 · LXL04_003117 · OH-1004

Mitochondrion0.043

Rank 4 · LXL04_003117 · OH-1004

Endoplasmic reticulum0.031

Rank 5 · LXL04_003117 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase92-241 aa

PF07714.24PK_Tyr_Ser-Thr93-242 aa

PF03109.23ABC1162-244 aa

PF00069.32Pkinase289-398 aa

PF07714.24PK_Tyr_Ser-Thr302-361 aa

PF00433.30Pkinase_C417-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003117	`PF00069.32`	Pkinase	92	241	2.7e-66	224.4
LXL04_003117	`PF07714.24`	PK_Tyr_Ser-Thr	93	242	2.8e-29	102.9
LXL04_003117	`PF03109.23`	ABC1	162	244	7.2e-08	32.6
LXL04_003117	`PF00069.32`	Pkinase	289	398	2.7e-66	224.4
LXL04_003117	`PF07714.24`	PK_Tyr_Ser-Thr	302	361	2.8e-29	102.9
LXL04_003117	`PF00433.30`	Pkinase_C	417	462	7.8e-07	30.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card