TkA06G443300 | RubberDandelionOmics

Gene overview

TkA06G443300

Reference: TK1151 Chr: Chr06 Coordinates: 109546924-109549678 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1485 bp · TkA06G443300|TK1151|cDNA

TATATGGTAAGTTAAAAGAAATTATATGGTGAAAAGACAATTCAATCAGATGGTGAGTAAAAATTACAAATCGGGCCCCTCCTTTTACCAATTCAATCGGATCGCCAGAGATAATTCAATTCTTCGCTCCAGTAGTAGTACGAGCACGAGAAGCACATGTCGCCGGTGGTTATCCCTCCGTCCTCGATCCAACGGTGGCGGCTCTGCAGTAGATCGCCTGCTGCGCTTCTTCACTCCATTCGCTCTGACCTAGACCTTCG...

CDS

Download CDS FASTA

432 bp · TkA06G443300|TK1151|CDS

ATGAAGCATCTTGATGTAGCTGGTGGGACAGGAGATGTGGCTTTCAGGATTCTTGAAACTGTCAACAGTGTGAATCGAAGAGCGATAGCAGACACACTTGAAGATGATTTACAGCAAGAAACTCAGATTTATGTCTATGATATAAATCCAAACATGTTGGATGTTGGTAGAAAAAGAGCCCAACAAAGAGGGCTTGGAGAACAAGGGTCCCTGATTTGGGTTGAAGGAGATGAGAAAAACTCAATTTTGAAGATAATTCA...

Protein

Download Protein FASTA

143 aa · TkA06G443300|TK1151|PROTEIN

MKHLDVAGGTGDVAFRILETVNSVNRRAIADTLEDDLQQETQIYVYDINPNMLDVGRKRAQQRGLGEQGSLIWVEGDEKNSILKIIQWMVTQLLLVLEMLHILKKFLLKHIECSKREGDSFALNSAMLKLLFLSKCMITIHFQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G443300`
TK1151 ID	TkA06G443300
OH-1004 ID	LXL04_017945
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 53.846 / OH-1004 26.552 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G443300

Location Chr06:109546924-109549678 (-)

Description Similar to COQ5: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57300`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0976600`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017945 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0008425 2-methoxy-6-polyprenyl-1,4-benzoquinol methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G57300

bta:533208

dosa:Os01g0976600

gga:416975

hsa:84274

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.413

Rank 1 · TkA06G443300 · TK1151

Nucleus0.313

Rank 2 · TkA06G443300 · TK1151

Mitochondrion0.153

Rank 3 · TkA06G443300 · TK1151

Endoplasmic reticulum0.126

Rank 4 · TkA06G443300 · TK1151

Extracellular0.075

Rank 5 · TkA06G443300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13847Methyltransf_311-65 aa

PF01209Ubie_methyltran2-66 aa

PF13649Methyltransf_254-22 aa

PF08242Methyltransf_124-78 aa

PF29470Ccs4_C25-50 aa

PF13649Methyltransf_2536-77 aa

PF08241Methyltransf_1140-77 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G443300	`PF13847`	Methyltransf_31	1	65	0.0024	18.4
TkA06G443300	`PF01209`	Ubie_methyltran	2	66	4.9e-09	36.6
TkA06G443300	`PF13649`	Methyltransf_25	4	22	0.00043	21.6
TkA06G443300	`PF08242`	Methyltransf_12	4	78	0.0016	19.8
TkA06G443300	`PF29470`	Ccs4_C	25	50	0.22	12.8
TkA06G443300	`PF13649`	Methyltransf_25	36	77	0.00043	21.6
TkA06G443300	`PF08241`	Methyltransf_11	40	77	0.12	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVC8`	Arabidopsis thaliana	sp\|Q9LVC8\|COQ5_ARATH 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	67.500%	Swiss-Prot	Medium
`Q5JNC0`	Oryza sativa subsp. japonica	sp\|Q5JNC0\|COQ5_ORYSJ 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	66.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card