LXL04_017945 | RubberDandelionOmics

Gene overview

LXL04_017945

Reference: OH-1004 Chr: Chr04 Coordinates: 4145019-4146490 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

873 bp · LXL04_017945|LXL04_017945|OH1004|cDNA

ATGTCCTTCAGACTGGTTGCCAGGAGATTATTGAGGACCAAACTCTTACCCATTTTCACTCCTGCATCTACACTGCATTCACATGCCACTAGCTTTGGATTTAAAGAAGTAAATGAAGACGAAAAAAGCCAACTTGTTGGTAATGTCTTCACTAAAGTTGCATCAAATTATGACATCATGAATGATTTGATGAGTGGTGGACTCCATAGGCTATGGAAAGAAAGACTTGTTTCAGAATTAAGCCCATTTCCTGGAATGAA...

CDS

Download CDS FASTA

873 bp · LXL04_017945|LXL04_017945|OH1004|CDS

ATGTCCTTCAGACTGGTTGCCAGGAGATTATTGAGGACCAAACTCTTACCCATTTTCACTCCTGCATCTACACTGCATTCACATGCCACTAGCTTTGGATTTAAAGAAGTAAATGAAGACGAAAAAAGCCAACTTGTTGGTAATGTCTTCACTAAAGTTGCATCAAATTATGACATCATGAATGATTTGATGAGTGGTGGACTCCATAGGCTATGGAAAGAAAGACTTGTTTCAGAATTAAGCCCATTTCCTGGAATGAA...

Protein

Download Protein FASTA

290 aa · LXL04_017945|LXL04_017945|OH1004|PROTEIN

MSFRLVARRLLRTKLLPIFTPASTLHSHATSFGFKEVNEDEKSQLVGNVFTKVASNYDIMNDLMSGGLHRLWKERLVSELSPFPGMKHLDVAGGTGDVAFRILETINSVNRRAIADTLEDDLQQETQIYVCDINPNMLDVGKKRAQQRGLGEQGSLIWVEGDAEKLNFEDNSMDGYTIAFGIRNVTHIEKVLAEAYRVLKKGGRFLCLELSHVEAPVFKQLYDYYSFSVIPVLGELVAGDRDSYQYLVESVRRFPPQEVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017945`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017945

Location Chr04:4145019-4146490 (+)

Description Similar to COQ5: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57300`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0976600`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017945 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0008425 2-methoxy-6-polyprenyl-1,4-benzoquinol methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G57300

bta:533208

dosa:Os01g0976600

gga:416975

hsa:84274

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.950

Rank 1 · LXL04_017945 · OH-1004

Cytoplasm0.074

Rank 2 · LXL04_017945 · OH-1004

Nucleus0.058

Rank 3 · LXL04_017945 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_017945 · OH-1004

Plastid0.017

Rank 5 · LXL04_017945 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01209.25Ubie_methyltran41-289 aa

PF13847.13Methyltransf_3184-220 aa

PF08242.19Methyltransf_1289-205 aa

PF13649.13Methyltransf_25121-203 aa

PF08241.19Methyltransf_11126-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017945	`PF01209.25`	Ubie_methyltran	41	289	1.1e-84	284.1
LXL04_017945	`PF13847.13`	Methyltransf_31	84	220	1.1e-10	42.2
LXL04_017945	`PF08242.19`	Methyltransf_12	89	205	8.1e-09	36.8
LXL04_017945	`PF13649.13`	Methyltransf_25	121	203	2.7e-15	57.6
LXL04_017945	`PF08241.19`	Methyltransf_11	126	207	6.3e-17	62.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVC8`	Arabidopsis thaliana	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	76.207%	Swiss-Prot	strong database homology
`Q5JNC0`	Oryza sativa subsp. japonica	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	70.508%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card