TkA06G442690 | RubberDandelionOmics

Gene overview

TkA06G442690

Reference: TK1151 Chr: Chr06 Coordinates: 109383272-109387259 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2075 bp · TkA06G442690|TK1151|cDNA

AAAAAAAGAAATCCCCAAACCCGGCACACACAGGTGACCAGCGGATGAAGGTGTAGAATAAGGGGGTTTTGAAGATGCGGCAGCATCATTAGCGGTGTTGGCGACGGGTATAAGCAGCTCCCGATCTCTGCTAATCGACACCCACATATAGACTGGAATCACACTAAAACGGTGAATCCAGTAGTCGCGAAGAGTCGGGGGATTTGTTGTTTCTCAGGAATCAAGGAGTAGATTAAAAATCGTTAAGCCCTAAGATAGAT...

CDS

Download CDS FASTA

585 bp · TkA06G442690|TK1151|CDS

ATGAGATCTGGTGGATCAAATACTTCTAGGCGACCTTGGCAGGCTGTCAATGATTATAATCAAAGGCATCATGATCAAGAGGAAAACAACGATGGATGGGAGACGGTTGGAAAGAAGCCTAAAAGAAAGCACAAACAGGTTGTTGACTATCACATTAAGCTTAGAAATGGAAGAAATGGAAGGTACCCTACAATGGGGAAACCACGGGGACCCGGTGGTAATGGCGGCTCACCATTCGAGGAGGCATTAATTGCCAACTT...

Protein

Download Protein FASTA

194 aa · TkA06G442690|TK1151|PROTEIN

MRSGGSNTSRRPWQAVNDYNQRHHDQEENNDGWETVGKKPKRKHKQVVDYHIKLRNGRNGRYPTMGKPRGPGGNGGSPFEEALIANFYHKIAKVMSKIGRITSQLYFPRYLEMRGAGGPWRRLCALPAFWIKEYSVVAFDYTKKRCTWSSSPPPSNNTVAASILSLHIFSQDLRRQEQNRLGRNPTAMDEQRQF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G442690`
TK1151 ID	TkA06G442690
OH-1004 ID	LXL04_033218
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.000
Protein coverage (%)	TK1151 64.433 / OH-1004 77.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G442690

Location Chr06:109383272-109387259 (+)

Description Similar to GSH1: Glutamate--cysteine ligase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23100`	Seems to play an important role in controlling the expression of resistance responses like the regulation of salicylic acid (SA) and phytoalexin (camalexin) production.	The ROOT MERISTEMLESS1/CADMIUM SENSITIVE2 gene defines a glutathione-dependent pathway involved in initiation and maintenance of cell division during postembryonic root development.2000 · DOI: 10.1105/tpc.12.1.97 The biological functions of glutathione revisited in arabidopsis transgenic plants with altered glutathione levels.2001 · DOI: 10.1104/pp.126.2.564 Level of glutathione is regulated by ATP-dependent ligation of glutamate and cysteine through photosynthesis in Arabidopsis thaliana: mechanism of strong interaction of light intensity with flowering.2004 · DOI: 10.1093/pcp/pch008 Evidence for a direct link between glutathione biosynthesis and stress defense gene expression in Arabidopsis.2004 · DOI: 10.1105/tpc.104.022608 Maturation of arabidopsis seeds is dependent on glutathione biosynthesis within the embryo.2006 · DOI: 10.1104/pp.106.077982 Identification of PAD2 as a gamma-glutamylcysteine synthetase highlights the importance of glutathione in disease resistance of Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2006.02938.x RML1 and RML2, Arabidopsis genes required for cell proliferation at the root tip.1995 · DOI: 10.1104/pp.107.2.365

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q8GU95`	Glutamate--cysteine ligase A, chloroplastic.	No verified direct reference in this release
`UniProt: A2YL07`	Glutamate--cysteine ligase B, chloroplastic.	No verified direct reference in this release
`Os07g0462000`	Glutamate--cysteine ligase B, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033218 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006750 glutathione biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0004357 glutamate-cysteine ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

dosa:Os07g0462000

mtr:11441054

nta:107799938

sly:543536

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.386

Rank 1 · TkA06G442690 · TK1151

Cytoplasm0.348

Rank 2 · TkA06G442690 · TK1151

Cell membrane0.146

Rank 3 · TkA06G442690 · TK1151

Mitochondrion0.132

Rank 4 · TkA06G442690 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA06G442690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46309`	Arabidopsis thaliana	sp\|P46309\|GSH1_ARATH Glutamate--cysteine ligase, chloroplastic	71.900%	Swiss-Prot	Low
`Q8GU95`	Oryza sativa subsp. indica	sp\|Q8GU95\|GSH1A_ORYSI Glutamate--cysteine ligase A, chloroplastic	71.900%	Swiss-Prot	Low
`A2YL07`	Oryza sativa subsp. indica	sp\|A2YL07\|GSH1B_ORYSI Glutamate--cysteine ligase B, chloroplastic	71.900%	Swiss-Prot	Low
`Q6Z3A3`	Oryza sativa subsp. japonica	sp\|Q6Z3A3\|GSH1B_ORYSJ Glutamate--cysteine ligase B, chloroplastic	71.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card