TkA06G442540 | RubberDandelionOmics

Gene overview

TkA06G442540

Reference: TK1151 Chr: Chr06 Coordinates: 109345548-109350255 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2337 bp · TkA06G442540|TK1151|cDNA

TTCCATTCCCGTCTCCTAACGTCAACTCCCAAGTGAAAAACCCACGTGATTCATCCAGTCACCATCGCCGCCGGGACACGTCATTTCACGGTGATTCCTCCGTCATAACTTCTGTGCCATGGCGGTGGCGACGACCTCCTCCAGCGACAACATCGCACCTCCATCACAATCCATGGATAAATCGCCTACGACGAATCTAGCCGATGCTGCTGCCGTAACGGAACCTGTGTCGGCGGTAAATGGTTCTCCATCTGCTGTTG...

CDS

Download CDS FASTA

1902 bp · TkA06G442540|TK1151|CDS

ATGGCGGTGGCGACGACCTCCTCCAGCGACAACATCGCACCTCCATCACAATCCATGGATAAATCGCCTACGACGAATCTAGCCGATGCTGCTGCCGTAACGGAACCTGTGTCGGCGGTAAATGGTTCTCCATCTGCTGTTGCGGTAGATCCGATTGATAACTCCAATTCCCCGTCCAGACCTTCCAGACAACTTGAATTTCAGCCGTCGCTGAGGAGTGAAGAATATCGACAACTGTTTCGTCTTCCTCCTGAAGAAGT...

Protein

Download Protein FASTA

633 aa · TkA06G442540|TK1151|PROTEIN

MAVATTSSSDNIAPPSQSMDKSPTTNLADAAAVTEPVSAVNGSPSAVAVDPIDNSNSPSRPSRQLEFQPSLRSEEYRQLFRLPPEEVLIQDFNCALQENFILQGHMYLFLHHICFYSNLFGFETKKIIAFNEITEVKRAKTAGIFPTAIELTASEKKYFFTSFLSRDEALKLINDGWIEHGNGSKAISDQQDSRSGVIDEETEIVMVEDSDEARSPGDYFETATTGGNTPEHPNRTPNRTPGSTPGTEADMSLRSSRVQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G442540`
TK1151 ID	TkA06G442540
OH-1004 ID	LXL04_022810
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.100
Protein coverage (%)	TK1151 99.210 / OH-1004 94.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G442540

Location Chr06:109345548-109350255 (-)

Description Similar to VAD1: Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02120`	Involved in ethylene- and salicylic acid-dependent cell death control associated with cells in the vicinity of vascular bundles.	Ethylene is one of the key elements for cell death and defense response control in the Arabidopsis lesion mimic mutant vad1.2007 · DOI: 10.1104/pp.107.106302

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022810 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0032366 intracellular sterol transport Biological Process

GO:0042632 cholesterol homeostasis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0071397 cellular response to cholesterol Biological Process

GO:0090120 lysosome to ER cholesterol transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G02120

hsa:54762

mmu:207798

mmu:235283

pon:100172272

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.314

Rank 1 · TkA06G442540 · TK1151

Endoplasmic reticulum0.287

Rank 2 · TkA06G442540 · TK1151

Cell membrane0.211

Rank 3 · TkA06G442540 · TK1151

Cytoplasm0.182

Rank 4 · TkA06G442540 · TK1151

Lysosome / Vacuole0.122

Rank 5 · TkA06G442540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02893GRAM76-177 aa

PF16016VASt302-446 aa

PF19221MELT494-506 aa

PF02893GRAM534-543 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G442540	`PF02893`	GRAM	76	177	3.8e-23	82.2
TkA06G442540	`PF16016`	VASt	302	446	2.9e-35	122.6
TkA06G442540	`PF19221`	MELT	494	506	0.23	12.2
TkA06G442540	`PF02893`	GRAM	534	543	3.8e-23	82.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HVW5`	Arabidopsis thaliana	sp\|F4HVW5\|VAD1_ARATH Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card