LXL04_022810 | RubberDandelionOmics

Gene overview

LXL04_022810

Reference: OH-1004 Chr: Chr05 Coordinates: 9969520-9974510 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1983 bp · LXL04_022810|LXL04_022810|OH1004|cDNA

ATGGCGGTGGCGACGACCTCCTCCAGCGACAACATCGCACCTCCATCACAATCCATGGATAAATCGCCTACGACGAATCTAGCCGATGCTGCTGCCGTAACGGAACCTGTGTCGGCGGTAAATGGTTCTCCATCTGCTGTTGCGGTAGATCCGATTGATAACTCCAATTCCCCGTCCAGACCTTCCAGACAACTTGAATTTCAGGTGCGATCAAGTTTCGTGATGAAATTTGGATTCGAAATTGAAGATCAACCGTCGCT...

CDS

Download CDS FASTA

1983 bp · LXL04_022810|LXL04_022810|OH1004|CDS

ATGGCGGTGGCGACGACCTCCTCCAGCGACAACATCGCACCTCCATCACAATCCATGGATAAATCGCCTACGACGAATCTAGCCGATGCTGCTGCCGTAACGGAACCTGTGTCGGCGGTAAATGGTTCTCCATCTGCTGTTGCGGTAGATCCGATTGATAACTCCAATTCCCCGTCCAGACCTTCCAGACAACTTGAATTTCAGGTGCGATCAAGTTTCGTGATGAAATTTGGATTCGAAATTGAAGATCAACCGTCGCT...

Protein

Download Protein FASTA

660 aa · LXL04_022810|LXL04_022810|OH1004|PROTEIN

MAVATTSSSDNIAPPSQSMDKSPTTNLADAAAVTEPVSAVNGSPSAVAVDPIDNSNSPSRPSRQLEFQVRSSFVMKFGFEIEDQPSLRSEEYRQLFRLPPEEVLIQDFNCALQENFILQKIIAFNEITEVKRAKTAGIFPTAIELTASEKKYFFTSFLSRDEALKLINDGWIEHGNGSKAISDQQDSRSGVIDEETEIVMVEDSDEARSPGDYFETATTGGNTPEHPNRTPNRTPGSTPGTEADMSLRSSRVQETAVDED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022810`
TK1151 ID	TkA06G442540
OH-1004 ID	LXL04_022810
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.100
Protein coverage (%)	TK1151 99.210 / OH-1004 94.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022810

Location Chr05:9969520-9974510 (+)

Description Similar to VAD1: Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02120`	Involved in ethylene- and salicylic acid-dependent cell death control associated with cells in the vicinity of vascular bundles.	Ethylene is one of the key elements for cell death and defense response control in the Arabidopsis lesion mimic mutant vad1.2007 · DOI: 10.1104/pp.107.106302

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022810 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0032366 intracellular sterol transport Biological Process

GO:0042632 cholesterol homeostasis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0071397 cellular response to cholesterol Biological Process

GO:0090120 lysosome to ER cholesterol transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G02120

hsa:54762

mmu:207798

mmu:235283

pon:100172272

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.307

Rank 1 · LXL04_022810 · OH-1004

Golgi apparatus0.274

Rank 2 · LXL04_022810 · OH-1004

Cytoplasm0.166

Rank 3 · LXL04_022810 · OH-1004

Cell membrane0.157

Rank 4 · LXL04_022810 · OH-1004

Nucleus0.139

Rank 5 · LXL04_022810 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02893.27GRAM120-171 aa

PF16016.12VASt296-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022810	`PF02893.27`	GRAM	120	171	3.8e-08	33.9
LXL04_022810	`PF16016.12`	VASt	296	440	2.9e-35	122.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HVW5`	Arabidopsis thaliana	Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic	42.634%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card