TkA06G440820 | RubberDandelionOmics

Gene overview

TkA06G440820

Reference: TK1151 Chr: Chr06 Coordinates: 108912701-108915868 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1929 bp · TkA06G440820|TK1151|cDNA

CTAGAACATACGAGTCGGGTCGAAAGAGGCGAGAAAAGTCGTGGCATTATCGTTGTTGACTTGAAATGAAAACCCGCCAACGGAACCTTCTCTATCCGCCTCTTGTCCACACCGATTTTTCCATAATATTTTTATATCAACAATAATTTCACAGCGTATCTTCCCAAATCACTCTTTCTATCCAAAAGATCTGATTCAATTCCATCTTCTTAATCGTTATTGGATCGTGATTTCTTGCAATTACATATAGTTTGAGGGGG...

CDS

Download CDS FASTA

1359 bp · TkA06G440820|TK1151|CDS

ATGGCGCAGAATCAAGGTGGTGGTGGTGGTTTCTTTTCGTCGATCGCTTCAAGTTTCTCCAGTTTCAAGAATCAAGTGAACGGACTTCTTGGTTATGAGGGACTTGAAGTTATTAACCCCGAGGGAGGCACTGATGATGCTGAAGTTGAAGCACAAAGAGGCAGATGGAAAGGAGAGGAGCGTGATAGTTACTGGAGGTCAATGCAGAAGTATGTGGGTGCTGACATCACATCAATGGTGACTTTACCAGTACTCATTTT...

Protein

Download Protein FASTA

452 aa · TkA06G440820|TK1151|PROTEIN

MAQNQGGGGGFFSSIASSFSSFKNQVNGLLGYEGLEVINPEGGTDDAEVEAQRGRWKGEERDSYWRSMQKYVGADITSMVTLPVLIFEPMTMLQKMAELMEYAHLLEQADNCEDPYMRLVYTASWFISVYYALQRTWKPFNPILGETYEMINHCGITFIAEQVSHHPPISAAHAENEHFVYDLTSKVKTKFLGNSVDVYPLGRTRLKLKKDGVILELVPPPTKVNNLIFGRTWIDSPGEMVLTNLTSGDKVVLYFQPCGW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G440820`
TK1151 ID	TkA06G440820
OH-1004 ID	LXL04_022813
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G440820

Location Chr06:108912701-108915868 (+)

Description Similar to ORP3A: Oxysterol-binding protein-related protein 3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02100`	Oxysterol-binding protein that may be involved in the transport of sterols between the ER and the Golgi.	The targeting of the oxysterol-binding protein ORP3a to the endoplasmic reticulum relies on the plant VAP33 homolog PVA12.2009 · DOI: 10.1111/j.1365-313x.2009.03815.x
`At5g59420`	May be involved in the transport of sterols.	No verified direct reference in this release
`At3g09300`	May be involved in the transport of sterols.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006897 endocytosis Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0015914 phospholipid transport Biological Process

GO:0030011 maintenance of cell polarity Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0050830 defense response to Gram-positive bacterium Biological Process

GO:0120011 intermembrane sterol transfer Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G09300

ath:AT5G02100

ath:AT5G59420

ddi:DDB_G0283709

spo:2540357

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · TkA06G440820 · TK1151

Golgi apparatus0.286

Rank 2 · TkA06G440820 · TK1151

Endoplasmic reticulum0.262

Rank 3 · TkA06G440820 · TK1151

Cell membrane0.185

Rank 4 · TkA06G440820 · TK1151

Nucleus0.162

Rank 5 · TkA06G440820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01237Oxysterol_BP63-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G440820	`PF01237`	Oxysterol_BP	63	421	1e-113	380.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZM1`	Arabidopsis thaliana	sp\|Q9LZM1\|ORP3A_ARATH Oxysterol-binding protein-related protein 3A	73.500%	Swiss-Prot	High
`Q93Y40`	Arabidopsis thaliana	sp\|Q93Y40\|ORP3C_ARATH Oxysterol-binding protein-related protein 3C	72.400%	Swiss-Prot	High
`Q9SR33`	Arabidopsis thaliana	sp\|Q9SR33\|ORP3B_ARATH Oxysterol-binding protein-related protein 3B	71.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card