RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G430860
Reference: TK1151 Chr: Chr06 Coordinates: 106611692-106612754 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

987 bp · TkA06G430860|TK1151|cDNA

AGAGTCCACATAAACGCACCCCTGTCTCTGACACCCTTTTTCTTTCTCCTTTTCCTCTCAATTTCACCGCTTCGATCATTATCAACTGTTGATTCCACTGACATACCACAGATCTTAGTCAATTTTCAACAACATGGACTCATCGGATGATGAAGGAGAGGAGTATCTGTTCAAAGTCGTCATCATCGGAGACTCGGCGGTCGGCAAATCAAACCTGCTCTCTAGGTACGCTCGGAATGAGTTCAATATGCACTCTAAAG...

CDS

Download CDS FASTA

654 bp · TkA06G430860|TK1151|CDS

ATGGACTCATCGGATGATGAAGGAGAGGAGTATCTGTTCAAAGTCGTCATCATCGGAGACTCGGCGGTCGGCAAATCAAACCTGCTCTCTAGGTACGCTCGGAATGAGTTCAATATGCACTCTAAAGCCACCATCGGAGTCGAATTTCAGACGCAGACCATGGAGATCGACGGCAAGGAGGTTAAGGCTCAGATTTGGGACACTGCCGGCCAAGAACGCTTCCGTGCCGTCACCTCTGCTTACTACCGCGGCGCTGTTGG...

Protein

Download Protein FASTA

217 aa · TkA06G430860|TK1151|PROTEIN

MDSSDDEGEEYLFKVVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQTMEIDGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDITRGTTFDSVTRWLEELKTHSDTTVARMLVGNKCDLDNIRAVSVEDGKNLAMKEGLFFMETSALDSTNVKTAFELVIREIYNNVSRKVLNSDSYKSELSMDRVTLTDDGGDGSKQNQSRYSCCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G430860
TK1151 IDTkA06G430860
OH-1004 IDLXL04_018640
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)77.100
Protein coverage (%)TK1151 96.774 / OH-1004 96.667
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G430860
LocationChr06:106611692-106612754 (+)
DescriptionSimilar to RABA5B: Ras-related protein RABA5b
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g05810 Intracellular vesicle trafficking and protein transport. No verified direct reference in this release
At2g31680 Intracellular vesicle trafficking and protein transport. No verified direct reference in this release
At2g43130 Intracellular vesicle trafficking and protein transport.
In vitro mutation analysis of Arabidopsis thaliana small GTP-binding proteins and detection of GAP-like activities in plant cells.1994 · DOI: 10.1016/0014-5793(94)80696-9
At3g07410 Intracellular vesicle trafficking and protein transport. No verified direct reference in this release
At5g47520 Intracellular vesicle trafficking and protein transport. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018640 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006886 intracellular protein transport Biological Process
GO:0009408 response to heat Biological Process
GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005777 peroxisome Cellular Component
GO:0005795 Golgi stack Cellular Component
GO:0005798 Golgi-associated vesicle Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G05810
ath:AT2G31680
ath:AT2G43130
ath:AT3G07410
ath:AT5G47520
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432
Rank 1 · TkA06G430860 · TK1151
Golgi apparatus0.381
Rank 2 · TkA06G430860 · TK1151
Cell membrane0.218
Rank 3 · TkA06G430860 · TK1151
Lysosome / Vacuole0.201
Rank 4 · TkA06G430860 · TK1151
Endoplasmic reticulum0.140
Rank 5 · TkA06G430860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf13-166 aa
PF00071Ras14-174 aa
PF08477Roc14-128 aa
PF01926MMR_HSR114-113 aa
PF09439SRPRB14-76 aa
PF05621TniB14-37 aa
PF20683DUF681926-65 aa
PF00009GTP_EFTU37-172 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G430860PF00025Arf131663.6e-1350.1
TkA06G430860PF00071Ras141742e-62210.3
TkA06G430860PF08477Roc141283e-34118.5
TkA06G430860PF01926MMR_HSR1141132.2e-0628.5
TkA06G430860PF09439SRPRB14760.06313.4
TkA06G430860PF05621TniB14370.1612.2
TkA06G430860PF20683DUF681926650.03314.6
TkA06G430860PF00009GTP_EFTU371723.8e-0730.6
TkA06G430860PF16748INSC_LBD1001130.1912.0
TkA06G430860PF09439SRPRB1421760.06313.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P19892Arabidopsis thalianasp|P19892|RAA5E_ARATH Ras-related protein RABA5e81.500%Swiss-ProtHigh
Q9SIP0Arabidopsis thalianasp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d80.300%Swiss-ProtHigh
P28187Arabidopsis thalianasp|P28187|RAA5C_ARATH Ras-related protein RABA5c77.400%Swiss-ProtHigh
Q9SRS5Arabidopsis thalianasp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b75.600%Swiss-ProtHigh
Q9FGK5Arabidopsis thalianasp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a62.100%Swiss-ProtHigh

JBrowse

View in Genome Browser