LXL04_018640 | RubberDandelionOmics

Gene overview

LXL04_018640

Reference: OH-1004 Chr: Chr04 Coordinates: 16143481-16144407 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_018640|LXL04_018640|OH1004|cDNA

taaacagTAAATATCCCTAATAAAATCCGTAAATTACGCATTTTTTTCAGCTTCCGACTACTTATTGTCTTCACTGTCTGTCCCCCAAATATAAACTCCACCATCGTCAACGCCATTTTCATAACACCTCTCTCTAGAATTCCGGCAAGAAAAATGGAAGACGGTGTAGGAGGAGAAGAGTACCTTTTCAAGATAGTAGTAATAGGCGACTCCGCCGTCGGAAAATCTAACCTGTTATCACGGTTCGCAAGAGACGAGTT...

CDS

Download CDS FASTA

633 bp · LXL04_018640|LXL04_018640|OH1004|CDS

ATGGAAGACGGTGTAGGAGGAGAAGAGTACCTTTTCAAGATAGTAGTAATAGGCGACTCCGCCGTCGGAAAATCTAACCTGTTATCACGGTTCGCAAGAGACGAGTTTGATCTGCACTCCAAGGCCACAATTGGTGTTGAATTTCAGACACAAGTGGTGGATATCGATGGCAAGGAAGTTAAAGCTCAAGTCTGGGACACCGCCGGTCAAGAACGGTTTCGTGCCGTCACCTCTGCATACTACCGGGGAGCCGTCGGAGC...

Protein

Download Protein FASTA

210 aa · LXL04_018640|LXL04_018640|OH1004|PROTEIN

MEDGVGGEEYLFKIVVIGDSAVGKSNLLSRFARDEFDLHSKATIGVEFQTQVVDIDGKEVKAQVWDTAGQERFRAVTSAYYRGAVGALIVYDISRRTTFDSIKRWLDELNTHCDTTTARMLVGNKSDLENIRDVSVEEGKRLAEEEGLFFIETSALDSTNVKEAFQIVIRAIYNNGRRKVLNSDSYKGELSSNRVSLINGSTKNGSCCSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018640`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018640

Location Chr04:16143481-16144407 (+)

Description Similar to RABA5B: Ras-related protein RABA5b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07410`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At2g31680`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At1g05810`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At2g43130`	Intracellular vesicle trafficking and protein transport.	In vitro mutation analysis of Arabidopsis thaliana small GTP-binding proteins and detection of GAP-like activities in plant cells.1994 · DOI: 10.1016/0014-5793(94)80696-9
`At5g47520`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018640 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0009408 response to heat Biological Process

GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005798 Golgi-associated vesicle Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G05810

ath:AT2G31680

ath:AT2G43130

ath:AT3G07410

ath:AT5G47520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.433

Rank 1 · LXL04_018640 · OH-1004

Golgi apparatus0.394

Rank 2 · LXL04_018640 · OH-1004

Cell membrane0.199

Rank 3 · LXL04_018640 · OH-1004

Lysosome / Vacuole0.174

Rank 4 · LXL04_018640 · OH-1004

Endoplasmic reticulum0.138

Rank 5 · LXL04_018640 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf11-170 aa

PF00071.29Ras13-173 aa

PF08477.20Roc13-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018640	`PF00025.28`	Arf	11	170	8.1e-15	55.4
LXL04_018640	`PF00071.29`	Ras	13	173	1.5e-61	207.4
LXL04_018640	`PF08477.20`	Roc	13	127	1.2e-33	116.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRS5`	Arabidopsis thaliana	Ras-related protein RABA5b	77.990%	Swiss-Prot	strong database homology
`Q9SIP0`	Arabidopsis thaliana	Ras-related protein RABA5d	77.103%	Swiss-Prot	strong database homology
`P19892`	Arabidopsis thaliana	Ras-related protein RABA5e	76.526%	Swiss-Prot	strong database homology
`P28187`	Arabidopsis thaliana	Ras-related protein RABA5c	76.699%	Swiss-Prot	strong database homology
`Q9FGK5`	Arabidopsis thaliana	Ras-related protein RABA5a	65.238%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card