RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G403330
Reference: TK1151 Chr: Chr06 Coordinates: 99861608-99863229 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1088 bp · TkA06G403330|TK1151|cDNA

GAAGTGAAATCAGGGAAATACGGATCGAAATCCGATTCTTATTCGATTGTAAGAACTTCTCAAGTTCCAGGGTTTCAGAATTTAAAAGATGTTGCTTTTCCGAGTTCACTCAGTGCTCACCAGAAGAGTCCACACTTTCCACCACGTCCAAAAAGATCTAATTCTCCACATTCTGGTACTACTACTCCTATGTTCTCAAGGGGTGTGATTGATGGTTTTAAAAAGTCAAATGATGTTTTGACTGAACAAGTTTCCAGATT...

CDS

Download CDS FASTA

1023 bp · TkA06G403330|TK1151|CDS

GAAGTGAAATCAGGGAAATACGGATCGAAATCCGATTCTTATTCGATTGTAAGAACTTCTCAAGTTCCAGGGTTTCAGAATTTAAAAGATGTTGCTTTTCCGAGTTCACTCAGTGCTCACCAGAAGAGTCCACACTTTCCACCACGTCCAAAAAGATCTAATTCTCCACATTCTGGTACTACTACTCCTATGTTCTCAAGGGGTGTGATTGATGGTTTTAAAAAGTCAAATGATGTTTTGACTGAACAAGTTTCCAGATT...

Protein

Download Protein FASTA

340 aa · TkA06G403330|TK1151|PROTEIN

EVKSGKYGSKSDSYSIVRTSQVPGFQNLKDVAFPSSLSAHQKSPHFPPRPKRSNSPHSGTTTPMFSRGVIDGFKKSNDVLTEQVSRLQNQVKHLKQKSDNQDADIKKLRNDSKHAESLAAAKAAKRAVAVDVFKSITSQLNELTEKLPPEITNDETFTSLTNKVNHYINTYGNDTSSNICSCSQSQSYQPEEISTPNKVIKKKYHKIDIEEPNKSQNPEISSQENNEASTSNNNTESQKRNEGGSRTRKHVRSEGVNEVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G403330
TK1151 IDTkA06G403330
OH-1004 IDLXL04_031244
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)35.100
Protein coverage (%)TK1151 92.647 / OH-1004 28.225
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G403330
LocationChr06:99861608-99863229 (-)
DescriptionSimilar to PRAF1: PH, RCC1 and FYVE domains-containing protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g76950 Binds to phosphatidic acid and to phosphoinositides such as PtdIns3P, PtdIns(3,4)P(2), PtdIns(3,4,5)P(3) and PtdIns(4,5)P(2). No verified direct reference in this release
At2g35600 May act as a regulator of cell proliferation and elongation in the root.
Characterization of the plant-specific BREVIS RADIX gene family reveals limited genetic redundancy despite high sequence conservation.2006 · DOI: 10.1104/pp.105.075382
At5g20540 Protein Brevis radix-like 4. No verified direct reference in this release
At1g54180 Protein Brevis radix-like 3. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0853500 Protein Brevis radix-like 4. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031244 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009411 response to UV Biological Process
GO:0009649 entrainment of circadian clock Biological Process
GO:0010224 response to UV-B Biological Process
GO:0010374 stomatal complex development Biological Process
GO:0000785 chromatin Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009536 plastid Cellular Component
GO:0003682 chromatin binding Molecular Function
GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function
KEGG gene cross-reference
ath:AT1G76950
ath:AT5G63860
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522
Rank 1 · TkA06G403330 · TK1151
Nucleus0.374
Rank 2 · TkA06G403330 · TK1151
Cell membrane0.212
Rank 3 · TkA06G403330 · TK1151
Endoplasmic reticulum0.045
Rank 4 · TkA06G403330 · TK1151
Golgi apparatus0.033
Rank 5 · TkA06G403330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24611Spectrin_Anc-169-151 aa
PF28175T4SS_LegC2C770-146 aa
PF17060MPS270-171 aa
PF01519DUF1673-117 aa
PF02183HALZ74-97 aa
PF08287DASH_Spc1978-142 aa
PF29599Rv0250c80-120 aa
PF04000Sas10_Utp380-122 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G403330PF24611Spectrin_Anc-1691510.03915.0
TkA06G403330PF28175T4SS_LegC2C7701460.001218.6
TkA06G403330PF17060MPS2701710.06812.9
TkA06G403330PF01519DUF16731171.210.3
TkA06G403330PF02183HALZ74970.2312.4
TkA06G403330PF08287DASH_Spc19781420.2412.0
TkA06G403330PF29599Rv0250c801200.1712.6
TkA06G403330PF04000Sas10_Utp3801221.710.0
TkA06G403330PF14197Cep57_CLD_2811110.008316.9
TkA06G403330PF23805DUF7180811130.1213.7
TkA06G403330PF09090MIF4G_like_2811481.78.8
TkA06G403330PF04977DivIC811176.67.3
TkA06G403330PF11839Alanine_zipper831270.5211.3
TkA06G403330PF04728LPP841170.6511.0
TkA06G403330PF23805DUF71801201400.1213.7
TkA06G403330PF13713BRX_N1231539.3e-0625.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q947D2Arabidopsis thalianasp|Q947D2|PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 130.500%Swiss-ProtMedium
O82281Arabidopsis thalianasp|O82281|BRXL1_ARATH Protein Brevis radix-like 150.800%Swiss-ProtLow
Q8GZ92Arabidopsis thalianasp|Q8GZ92|BRXL4_ARATH Protein Brevis radix-like 450.900%Swiss-ProtLow
Q5HZ09Arabidopsis thalianasp|Q5HZ09|BRXL3_ARATH Protein Brevis radix-like 341.000%Swiss-ProtLow
Q84T65Oryza sativa subsp. japonicasp|Q84T65|BRXL4_ORYSJ Protein Brevis radix-like 455.400%Swiss-ProtLow

JBrowse

View in Genome Browser