TkA06G395830 | RubberDandelionOmics

Gene overview

TkA06G395830

Reference: TK1151 Chr: Chr06 Coordinates: 98084002-98086981 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

949 bp · TkA06G395830|TK1151|cDNA

CTTTGTGATGGTTTATTGATAGTTTATAAGATTTGGATGCGGGGAAATTTCTTTGAAACTCATATGTGTCTCTCTATATATAACGTTCATTTCATTGAGGTCCAATCAATCAACTTATTGATGGCTTCTTCATCATCATCTTCTTCCTATCATTGCGCCTTTTCTTCTCAACCGTGGAAGTATCATGCTTTTCTTAGTTTTAGGGGAGAAGATACTAGCAAAACTTTTGTGGATCATCTTTACCTAGCTCTTGAACAACA...

CDS

Download CDS FASTA

762 bp · TkA06G395830|TK1151|CDS

ATGCGGGGAAATTTCTTTGAAACTCATATGTGTCTCTCTATATATAACGTTCATTTCATTGAGGTCCAATCAATCAACTTATTGATGGCTTCTTCATCATCATCTTCTTCCTATCATTGCGCCTTTTCTTCTCAACCGTGGAAGTATCATGCTTTTCTTAGTTTTAGGGGAGAAGATACTAGCAAAACTTTTGTGGATCATCTTTACCTAGCTCTTGAACAACAAGGAATTTACACATACAAAGAAGACAAATCACTTCC...

Protein

Download Protein FASTA

253 aa · TkA06G395830|TK1151|PROTEIN

MRGNFFETHMCLSIYNVHFIEVQSINLLMASSSSSSSYHCAFSSQPWKYHAFLSFRGEDTSKTFVDHLYLALEQQGIYTYKEDKSLPRGILIGPSLMKAIEESQIAIIIFSKNYVDSSWCLAELSHIMKCRDMSGQIVMPIFYDVDPSEVRRQKRKYEEAFAELENKTMVESWRKALVDASNISESEPNHIAKGHESKVIKEIVYKISHMLQPPTSSVSENLIRLEPYVEDLKSNVPMGLGSVHDRNMGGWGW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G395830`
TK1151 ID	TkA06G395830
OH-1004 ID	LXL04_023129
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.400
Protein coverage (%)	TK1151 75.494 / OH-1004 77.959 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G395830

Location Chr06:98084002-98086981 (+)

Description Similar to ROQ1: Disease resistance protein Roq1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44510`	TIR-NB-LRR receptor-like protein that contributes to disease resistance induced by the Pseudomonas syringae type III effector AvrB.	Arabidopsis TAO1 is a TIR-NB-LRR protein that contributes to disease resistance induced by the Pseudomonas syringae effector AvrB.2008 · DOI: 10.1073/pnas.0802157105
`At3g44480`	TIR-NB-LRR receptor-like protein that confers resistance to the pathogen Hyaloperonospora arabidopsis (By similarity).	No verified direct reference in this release
`At4g11170`	Putative disease resistance protein At4g11170.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023129 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010193 response to ozone Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G11170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.414

Rank 1 · TkA06G395830 · TK1151

Nucleus0.265

Rank 2 · TkA06G395830 · TK1151

Cell membrane0.264

Rank 3 · TkA06G395830 · TK1151

Plastid0.103

Rank 4 · TkA06G395830 · TK1151

Endoplasmic reticulum0.094

Rank 5 · TkA06G395830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00971EIAV_GP9013-44 aa

PF01582TIR48-217 aa

PF13676TIR_252-148 aa

PF18785Inv-AAD90-195 aa

PF00971EIAV_GP90100-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G395830	`PF00971`	EIAV_GP90	13	44	0.12	11.8
TkA06G395830	`PF01582`	TIR	48	217	2.4e-47	161.8
TkA06G395830	`PF13676`	TIR_2	52	148	1.5e-14	55.2
TkA06G395830	`PF18785`	Inv-AAD	90	195	0.038	14.5
TkA06G395830	`PF00971`	EIAV_GP90	100	184	0.12	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI14`	Arabidopsis thaliana	sp\|Q9FI14\|TAO1_ARATH Disease resistance protein TAO1	36.700%	Swiss-Prot	Medium
`F4J339`	Arabidopsis thaliana	sp\|F4J339\|RPP1_ARATH Probable disease resistance protein RPP1	38.500%	Swiss-Prot	Medium
`O82500`	Arabidopsis thaliana	sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card