TkA06G390560 | RubberDandelionOmics

Gene overview

TkA06G390560

Reference: TK1151 Chr: Chr06 Coordinates: 96790890-96794253 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3284 bp · TkA06G390560|TK1151|cDNA

CCAAGATTCAACAAACCAAACCACCGGCCATTTGGGTTTCCGGTAAGCTCACAACTGCCTTTTCATATCATATAAATCAAATACCTTTTCTACTTATGATTTCCGAATAAAGTTTGATTCTTCGCTATGGGTTTTTTCTGGGTAATCGTTCTCTTGTTTCCGTTTCGTGATTCTATGGACAAATGGGGTTTTGTTTGACTTTTGTTTTGTTAACTGACGTAAGATCTGATGAATTGATGGTTGATGGATTTGAAGGCGTT...

CDS

Download CDS FASTA

1500 bp · TkA06G390560|TK1151|CDS

ATGAATGTCCTTCTGAAATGTATCAGAAATCCGAATGCACAAAAGATGGTGACAGAATTTGCGAGTATAACTGCTCGAATTGTACCTCGGCTCAGTGTACTTCAAATTGTTCGTATTCTGATAAGAAATCGGAAAGATTTTGGTCACTCCAGTTGCCGGTTAAGAAACTGTAATTGCTCAACTAAAGGAGTTAAAATCATAAAAAATGGGTTTCAGAAAGATGGAGGGAAGATTCAACCGGATTTGGAGGAGCTAAAGAT...

Protein

Download Protein FASTA

499 aa · TkA06G390560|TK1151|PROTEIN

MNVLLKCIRNPNAQKMVTEFASITARIVPRLSVLQIVRILIRNRKDFGHSSCRLRNCNCSTKGVKIIKNGFQKDGGKIQPDLEELKIRRARVFSYDELEKATGGFVEESQVGRGSFSCVFKGILKDGVVVAVKRAILSPDMKKNSMEFHNELDLLSRLNHAHLLNLLGYCEEGEQRLLVYEFMANGSLHQHLHGNPKELKSQLDWVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADFGLSLLGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G390560`
TK1151 ID	TkA06G390560
OH-1004 ID	LXL04_023169
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.500
Protein coverage (%)	TK1151 98.998 / OH-1004 53.804 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G390560

Location Chr06:96790890-96794253 (+)

Description Similar to ACR4: Serine/threonine-protein kinase-like protein ACR4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59420`	Controls formative cell division in meristems, including root tips and lateral root initiation zones of the pericycle, in response to CLE40 signal.	No verified direct reference in this release
`At3g55950`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At5g47850`	Serine/threonine-protein kinase-like protein CCR4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0637800`	Receptor protein kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023169 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010311 lateral root formation Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0048439 flower morphogenesis Biological Process

GO:0048829 root cap development Biological Process

GO:0080136 priming of cellular response to stress Biological Process

GO:0090392 sepal giant cell differentiation Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0099402 plant organ development Biological Process

KEGG gene cross-reference

ath:AT2G39180

ath:AT3G59420

ath:AT5G47850

dosa:Os03g0637800

zma:542346

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.672

Rank 1 · TkA06G390560 · TK1151

Nucleus0.238

Rank 2 · TkA06G390560 · TK1151

Cytoplasm0.233

Rank 3 · TkA06G390560 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA06G390560 · TK1151

Golgi apparatus0.031

Rank 5 · TkA06G390560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-39 aa

PF00069Pkinase106-374 aa

PF03109ABC1107-152 aa

PF07714PK_Tyr_Ser-Thr108-377 aa

PF01636APH145-210 aa

PF03109ABC1229-256 aa

PF01636APH230-260 aa

PF01636APH291-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G390560	`PF07714`	PK_Tyr_Ser-Thr	2	39	1e-44	153.5
TkA06G390560	`PF00069`	Pkinase	106	374	9.2e-43	147.2
TkA06G390560	`PF03109`	ABC1	107	152	0.00019	21.4
TkA06G390560	`PF07714`	PK_Tyr_Ser-Thr	108	377	1e-44	153.5
TkA06G390560	`PF01636`	APH	145	210	0.0054	17.2
TkA06G390560	`PF03109`	ABC1	229	256	0.00019	21.4
TkA06G390560	`PF01636`	APH	230	260	0.0054	17.2
TkA06G390560	`PF01636`	APH	291	345	0.0054	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX29`	Arabidopsis thaliana	sp\|Q9LX29\|ACR4L_ARATH Serine/threonine-protein kinase-like protein ACR4	75.700%	Swiss-Prot	High
`Q9LY50`	Arabidopsis thaliana	sp\|Q9LY50\|ACCR3_ARATH Putative serine/threonine-protein kinase-like protein CCR3	48.600%	Swiss-Prot	Medium
`Q9FIJ6`	Arabidopsis thaliana	sp\|Q9FIJ6\|ACCR4_ARATH Serine/threonine-protein kinase-like protein CCR4	49.400%	Swiss-Prot	Medium
`Q75J39`	Oryza sativa subsp. japonica	sp\|Q75J39\|CKI4_ORYSJ Serine/threonine-protein kinase-like protein CR4	77.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card