LXL04_023169 | RubberDandelionOmics

Gene overview

LXL04_023169

Reference: OH-1004 Chr: Chr05 Coordinates: 25551560-25554322 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2763 bp · LXL04_023169|LXL04_023169|OH1004|cDNA

ATGGGGTTTTTGAGATGTTTTCTTGACAATATAACGCTACAAACCCTACTGTTCATGGTGGTTGCATCGGATTTAAACAGTTTAGTGATAGGCCTTGGGTCAATGTCGTCAATAGCCATATCATACGGTGAATATGGTTCAGCTTTTTGTGGTCTAAGATCAGATGGTTCACACCTTGTGACATGTTACGGTTCGAACCCGGCTCTCACCGGTTCGACTCCTTCACTCACACGGTTCACGGGTTTAACAGCTGGTAACGG...

CDS

Download CDS FASTA

2763 bp · LXL04_023169|LXL04_023169|OH1004|CDS

ATGGGGTTTTTGAGATGTTTTCTTGACAATATAACGCTACAAACCCTACTGTTCATGGTGGTTGCATCGGATTTAAACAGTTTAGTGATAGGCCTTGGGTCAATGTCGTCAATAGCCATATCATACGGTGAATATGGTTCAGCTTTTTGTGGTCTAAGATCAGATGGTTCACACCTTGTGACATGTTACGGTTCGAACCCGGCTCTCACCGGTTCGACTCCTTCACTCACACGGTTCACGGGTTTAACAGCTGGTAACGG...

Protein

Download Protein FASTA

920 aa · LXL04_023169|LXL04_023169|OH1004|PROTEIN

MGFLRCFLDNITLQTLLFMVVASDLNSLVIGLGSMSSIAISYGEYGSAFCGLRSDGSHLVTCYGSNPALTGSTPSLTRFTGLTAGNGFVCGLLSNTSQPFCWGVSDFIAMGVPKPMNKFAEFVELSAGDHHLCGLRKPLTGNRRNISVVDCWGYNMTKSHVFDGPVRSVSAGSEFNCGLFSENRTAFCWGDETSSGVISSVPRNVRFKKISAGGYHVCGIIEGVDSNVSCWGTSWESQQEIAVELAGQGQGQVNFDLTPH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023169`
TK1151 ID	TkA06G390560
OH-1004 ID	LXL04_023169
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.500
Protein coverage (%)	TK1151 98.998 / OH-1004 53.804 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023169

Location Chr05:25551560-25554322 (-)

Description Similar to ACR4: Serine/threonine-protein kinase-like protein ACR4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59420`	Controls formative cell division in meristems, including root tips and lateral root initiation zones of the pericycle, in response to CLE40 signal.	No verified direct reference in this release
`At5g47850`	Serine/threonine-protein kinase-like protein CCR4.	No verified direct reference in this release
`At2g39180`	Serine/threonine-protein kinase with low activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0637800`	Receptor protein kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023169 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010311 lateral root formation Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0048439 flower morphogenesis Biological Process

GO:0048829 root cap development Biological Process

GO:0080136 priming of cellular response to stress Biological Process

GO:0090392 sepal giant cell differentiation Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0099402 plant organ development Biological Process

KEGG gene cross-reference

ath:AT2G39180

ath:AT3G59420

ath:AT5G47850

dosa:Os03g0637800

zma:542346

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.793

Rank 1 · LXL04_023169 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_023169 · OH-1004

Endoplasmic reticulum0.098

Rank 3 · LXL04_023169 · OH-1004

Nucleus0.062

Rank 4 · LXL04_023169 · OH-1004

Lysosome / Vacuole0.046

Rank 5 · LXL04_023169 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13540.13RCC1_2166-193 aa

PF00069.32Pkinase527-795 aa

PF07714.24PK_Tyr_Ser-Thr529-798 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023169	`PF13540.13`	RCC1_2	166	193	3.1e-10	40.3
LXL04_023169	`PF00069.32`	Pkinase	527	795	3.5e-42	145.3
LXL04_023169	`PF07714.24`	PK_Tyr_Ser-Thr	529	798	3.3e-44	151.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX29`	Arabidopsis thaliana	Serine/threonine-protein kinase-like protein ACR4	64.161%	Swiss-Prot	strong database homology
`Q9FIJ6`	Arabidopsis thaliana	Serine/threonine-protein kinase-like protein CCR4	34.191%	Swiss-Prot	moderate database homology
`O80963`	Arabidopsis thaliana	Serine/threonine-protein kinase-like protein CCR2	31.084%	Swiss-Prot	moderate database homology
`Q75J39`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase-like protein CR4	63.457%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card