TkA06G390040 | RubberDandelionOmics

Gene overview

TkA06G390040

Reference: TK1151 Chr: Chr06 Coordinates: 96638635-96642578 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1914 bp · TkA06G390040|TK1151|cDNA

AAACAGTGTACCACCGCATCTGTACTTTTGCTATGTCTGGACTGAAAGGCAGAAAGGCCACGCTTCACATGCCTCAGAAATGGTAACTTATTGATTAATGAAGTAAATTAGATGCACAAATTGAAGAAAACTCCCACAAAAAATCTTCTTCGTCTTCCTCTGCAATCCACCATCTCGCCACACCAATCGGAAGCAAGTAACGGCATTCAACCGCATAAATCCATTCCATGATTGGTGTTCGTTGACGGTGTTTTTGATAT...

CDS

Download CDS FASTA

1056 bp · TkA06G390040|TK1151|CDS

ATGGGCGTTTCTGGAAAGTGGATTAGAGCACTCATTGGTTTGAAGAAACAAGAAAAATCACAACGTTCAGGAGAAGATGGACATAGGGGCAAAACCGGAAAGTTTGGCCACCGCAGAAGAAGTTCTACAGAGATAAAGAGTGGCATTTTTGTAAATAAGTTGAATGAAGATGGCAATAGCAGTGCAGTTCAAGATGTTACCGACTCAGTGTCTGACTCACCTCAGATGGAACAGCGTATGAGAGAAGAGTGGGCAGCTAC...

Protein

Download Protein FASTA

351 aa · TkA06G390040|TK1151|PROTEIN

MGVSGKWIRALIGLKKQEKSQRSGEDGHRGKTGKFGHRRRSSTEIKSGIFVNKLNEDGNSSAVQDVTDSVSDSPQMEQRMREEWAATYIQTAFRGFLARRALRALKGLVRLQALVRGHAVRKQAATTLRCMQALVRVQARVRARRVRVALEEGQSHQPKLQHQLQHEAHVREIEQGWCDSVGSVEEIQAKLIKRQEAAAKRERAMAYALAHQWQAGSKQPVVPSGSGFEPDKSNWGWNWLERWMAVRPWENRFLDEVKIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G390040`
TK1151 ID	TkA06G390040
OH-1004 ID	LXL04_023171
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 99.715 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G390040

Location Chr06:96638635-96642578 (-)

Description Similar to IQD1: Protein IQ-DOMAIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22190`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	The Microtubule-Associated Protein IQ67 DOMAIN5 Modulates Microtubule Dynamics and Pavement Cell Shape.2018 · DOI: 10.1104/pp.18.00558 Microtubule-associated protein IQ67 DOMAIN5 regulates morphogenesis of leaf pavement cells in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery395
`At2g26180`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g72670`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g52290`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g03040`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023171 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0070507 regulation of microtubule cytoskeleton organization Biological Process

GO:0072699 protein localization to cortical microtubule cytoskeleton Biological Process

GO:0090436 leaf pavement cell development Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT1G72670

ath:AT2G26180

ath:AT3G22190

ath:AT3G52290

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.417

Rank 1 · TkA06G390040 · TK1151

Cell membrane0.393

Rank 2 · TkA06G390040 · TK1151

Nucleus0.340

Rank 3 · TkA06G390040 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA06G390040 · TK1151

Plastid0.042

Rank 5 · TkA06G390040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24609IQ_SCN5A_C79-106 aa

PF00612IQ84-103 aa

PF00612IQ109-123 aa

PF21627BTH_I2711-like115-148 aa

PF00612IQ133-148 aa

PF27823SCD2_helical_N138-138 aa

PF00435Spectrin161-215 aa

PF27823SCD2_helical_N165-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G390040	`PF24609`	IQ_SCN5A_C	79	106	0.00056	20.1
TkA06G390040	`PF00612`	IQ	84	103	1.6e-06	28.1
TkA06G390040	`PF00612`	IQ	109	123	1.6e-06	28.1
TkA06G390040	`PF21627`	BTH_I2711-like	115	148	0.075	14.1
TkA06G390040	`PF00612`	IQ	133	148	1.6e-06	28.1
TkA06G390040	`PF27823`	SCD2_helical_N	138	138	0.38	11.7
TkA06G390040	`PF00435`	Spectrin	161	215	0.052	14.7
TkA06G390040	`PF27823`	SCD2_helical_N	165	215	0.38	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J061`	Arabidopsis thaliana	sp\|F4J061\|IQD5_ARATH Protein IQ-DOMAIN 5	53.300%	Swiss-Prot	High
`O64852`	Arabidopsis thaliana	sp\|O64852\|IQD6_ARATH Protein IQ-DOMAIN 6	51.700%	Swiss-Prot	High
`Q9CAI2`	Arabidopsis thaliana	sp\|Q9CAI2\|IQD8_ARATH Protein IQ-DOMAIN 8	40.700%	Swiss-Prot	Medium
`Q9FT53`	Arabidopsis thaliana	sp\|Q9FT53\|IQD3_ARATH Protein IQ-DOMAIN 3	38.900%	Swiss-Prot	Medium
`Q93ZH7`	Arabidopsis thaliana	sp\|Q93ZH7\|IQD2_ARATH Protein IQ-DOMAIN 2	42.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card