TkA06G380100 | RubberDandelionOmics

Gene overview

TkA06G380100

Reference: TK1151 Chr: Chr06 Coordinates: 94144668-94145318 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkA06G380100|TK1151|cDNA

ATGGCTGCCATCTGCTCCAGAATCTTCCTCTTCTACAATCTCATCTACACAATCTTCCTTTCTTTACTTCCGAAGAATCTCAGACATTACCTCCCTTCTTCTTACAATCCACACCAACAACAGATCCACGAAGTCGCCACCACCACCACATCCCCGTCACTCCCACCTCCATCAACACCACGTTCTTCTCGCATGGATCGCGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAGAATCACCAA...

CDS

Download CDS FASTA

651 bp · TkA06G380100|TK1151|CDS

ATGGCTGCCATCTGCTCCAGAATCTTCCTCTTCTACAATCTCATCTACACAATCTTCCTTTCTTTACTTCCGAAGAATCTCAGACATTACCTCCCTTCTTCTTACAATCCACACCAACAACAGATCCACGAAGTCGCCACCACCACCACATCCCCGTCACTCCCACCTCCATCAACACCACGTTCTTCTCGCATGGATCGCGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAGAATCACCAA...

Protein

Download Protein FASTA

216 aa · TkA06G380100|TK1151|PROTEIN

MAAICSRIFLFYNLIYTIFLSLLPKNLRHYLPSSYNPHQQQIHEVATTTTSPSLPPPSTPRSSRMDRDQLQRIFQMFDKNGDARITKEELNDSLENMGIFIPDSDLTQMIENIDENHDGCVDIDEFGALYKSIMDDRENEEDVMEAFNVFDQNRDGFITVEELRSVLESLGLKQGRKADDCRRMIMKVDVDGDGMVSFTEFKEMMRSGGLSAMAQN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G380100`
TK1151 ID	TkA06G380100
OH-1004 ID	LXL04_023266
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G380100

Location Chr06:94144668-94145318 (+)

Description Similar to CML5: Calmodulin-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07490`	Potential calcium sensor.	No verified direct reference in this release
`At2g43290`	Potential calcium sensor.	No verified direct reference in this release
`At4g12860`	Potential calcium sensor that is required for pollen tube attraction for ovule fertilization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0228800`	Potential calcium sensor.	No verified direct reference in this release
`Os02g0606600`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05990

ath:AT2G43290

ath:AT3G07490

ath:AT3G59440

dosa:Os12g0228800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.268

Rank 1 · TkA06G380100 · TK1151

Cytoplasm0.264

Rank 2 · TkA06G380100 · TK1151

Nucleus0.245

Rank 3 · TkA06G380100 · TK1151

Cell membrane0.129

Rank 4 · TkA06G380100 · TK1151

Plastid0.092

Rank 5 · TkA06G380100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004AAA39-69 aa

PF10591SPARC_Ca_bdg61-127 aa

PF23256CHX17_2nd62-82 aa

PF25578EF-hand_STIM163-92 aa

PF23564EF-hand_FSTL164-97 aa

PF10869DUF266664-112 aa

PF12763EH65-135 aa

PF22592FCaBP_EF-hand65-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G380100	`PF00004`	AAA	39	69	0.15	13.3
TkA06G380100	`PF10591`	SPARC_Ca_bdg	61	127	1.7e-06	29.1
TkA06G380100	`PF23256`	CHX17_2nd	62	82	0.27	12.1
TkA06G380100	`PF25578`	EF-hand_STIM1	63	92	0.044	14.6
TkA06G380100	`PF23564`	EF-hand_FSTL1	64	97	1.9e-08	35.4
TkA06G380100	`PF10869`	DUF2666	64	112	0.097	13.7
TkA06G380100	`PF12763`	EH	65	135	9.8e-06	26.2
TkA06G380100	`PF22592`	FCaBP_EF-hand	65	94	0.00077	20.4
TkA06G380100	`PF30551`	CFAP251_C	65	115	0.018	15.4
TkA06G380100	`PF05042`	Caleosin	66	95	0.0049	17.5
TkA06G380100	`PF30624`	EF_SSP120	67	89	4.5e-06	27.9
TkA06G380100	`PF13499`	EF-hand_7	68	130	1.3e-29	103.0
TkA06G380100	`PF13833`	EF-hand_8	68	95	1.1e-11	45.0
TkA06G380100	`PF13405`	EF-hand_6	69	98	4.1e-26	88.9
TkA06G380100	`PF00036`	EF-hand_1	70	93	3.7e-29	98.8
TkA06G380100	`PF24548`	EF_EFCAB10_C	70	113	4.7e-11	42.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRR7`	Arabidopsis thaliana	sp\|Q9SRR7\|CML3_ARATH Calmodulin-like protein 3	68.400%	Swiss-Prot	High
`O22845`	Arabidopsis thaliana	sp\|O22845\|CML5_ARATH Calmodulin-like protein 5	56.800%	Swiss-Prot	High
`Q9SU00`	Arabidopsis thaliana	sp\|Q9SU00\|CML2_ARATH Calmodulin-like protein 2	54.600%	Swiss-Prot	High
`Q2QVI1`	Oryza sativa subsp. japonica	sp\|Q2QVI1\|CML28_ORYSJ Probable calcium-binding protein CML28	51.200%	Swiss-Prot	Medium
`Q0DZP5`	Oryza sativa subsp. japonica	sp\|Q0DZP5\|CML17_ORYSJ Probable calcium-binding protein CML17	46.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card