LXL04_023266 | RubberDandelionOmics

Gene overview

LXL04_023266

Reference: OH-1004 Chr: Chr05 Coordinates: 29460019-29460678 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · LXL04_023266|LXL04_023266|OH1004|cDNA

ATGGCTGCCATCTGCTCCAGAATCTTCCTCTTCTACAATCTCATCTAtacaatcttcctttctttACTTCCGAAGAATCTCAGACATTACCTCCCTTCTTCTTACAATCCACACCAACAACAGATCCACGAAGTCGCCactaccaccaccaccaccacttcCCCGTTACTCCCACCTCCATCAACACCGCGTTCTTCTCGCATGGATCGGGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAG...

CDS

Download CDS FASTA

660 bp · LXL04_023266|LXL04_023266|OH1004|CDS

ATGGCTGCCATCTGCTCCAGAATCTTCCTCTTCTACAATCTCATCTATACAATCTTCCTTTCTTTACTTCCGAAGAATCTCAGACATTACCTCCCTTCTTCTTACAATCCACACCAACAACAGATCCACGAAGTCGCCACTACCACCACCACCACCACTTCCCCGTTACTCCCACCTCCATCAACACCGCGTTCTTCTCGCATGGATCGGGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAG...

Protein

Download Protein FASTA

219 aa · LXL04_023266|LXL04_023266|OH1004|PROTEIN

MAAICSRIFLFYNLIYTIFLSLLPKNLRHYLPSSYNPHQQQIHEVATTTTTTTSPLLPPPSTPRSSRMDRDQLQRIFQMFDKNGDARITKEELNDSLENMGIFIPDSDLTQMIENIDENHDGCVDIDEFGALYKSIMDDRENEEDVMEAFNVFDQNRDGFITVEELRSVLESLGLKQGRKADDCRRMIMKVDVDGDGMVSFTEFKEMMRSGGLSAMAQN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023266`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023266

Location Chr05:29460019-29460678 (+)

Description Similar to CML5: Calmodulin-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43290`	Potential calcium sensor.	No verified direct reference in this release
`At3g07490`	Potential calcium sensor.	No verified direct reference in this release
`At3g59440`	Potential calcium sensor.	No verified direct reference in this release
`At1g05990`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0228800`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023266 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05990

ath:AT2G43290

ath:AT3G07490

ath:AT3G59440

dosa:Os12g0228800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.265

Rank 1 · LXL04_023266 · OH-1004

Cytoplasm0.254

Rank 2 · LXL04_023266 · OH-1004

Nucleus0.244

Rank 3 · LXL04_023266 · OH-1004

Cell membrane0.122

Rank 4 · LXL04_023266 · OH-1004

Plastid0.106

Rank 5 · LXL04_023266 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_771-133 aa

PF13405.13EF-hand_672-101 aa

PF00036.39EF-hand_173-96 aa

PF13202.13EF-hand_574-94 aa

PF00036.39EF-hand_1109-135 aa

PF13499.13EF-hand_7143-209 aa

PF00036.39EF-hand_1146-172 aa

PF13405.13EF-hand_6146-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023266	`PF13499.13`	EF-hand_7	71	133	1.4e-29	102.9
LXL04_023266	`PF13405.13`	EF-hand_6	72	101	4.5e-26	88.8
LXL04_023266	`PF00036.39`	EF-hand_1	73	96	4e-29	98.7
LXL04_023266	`PF13202.13`	EF-hand_5	74	94	1.2e-21	75.8
LXL04_023266	`PF00036.39`	EF-hand_1	109	135	4e-29	98.7
LXL04_023266	`PF13499.13`	EF-hand_7	143	209	1.4e-29	102.9
LXL04_023266	`PF00036.39`	EF-hand_1	146	172	4e-29	98.7
LXL04_023266	`PF13405.13`	EF-hand_6	146	174	4.5e-26	88.8
LXL04_023266	`PF13202.13`	EF-hand_5	148	170	1.2e-21	75.8
LXL04_023266	`PF14658.13`	EF-hand_9	149	209	8.4e-07	30.1
LXL04_023266	`PF13833.13`	EF-hand_8	159	209	1.2e-11	44.9
LXL04_023266	`PF00036.39`	EF-hand_1	183	210	4e-29	98.7
LXL04_023266	`PF13405.13`	EF-hand_6	186	212	4.5e-26	88.8
LXL04_023266	`PF13202.13`	EF-hand_5	189	208	1.2e-21	75.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22845`	Arabidopsis thaliana	Calmodulin-like protein 5	56.542%	Swiss-Prot	strong database homology
`Q9SRR7`	Arabidopsis thaliana	Calmodulin-like protein 3	72.368%	Swiss-Prot	moderate database homology
`Q9LX27`	Arabidopsis thaliana	Calmodulin-like protein 4	53.846%	Swiss-Prot	strong database homology
`Q9LNE7`	Arabidopsis thaliana	Calmodulin-like protein 7	64.667%	Swiss-Prot	moderate database homology
`Q2QVI1`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML28	56.140%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card