TkA06G374910 | RubberDandelionOmics

Gene overview

TkA06G374910

Reference: TK1151 Chr: Chr06 Coordinates: 92815009-92816151 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1098 bp · TkA06G374910|TK1151|cDNA

ATGGCTGCATGGGTAAACGCACATTTCTTGCATAAAAACTTACTTATAGACATAGACGCACCTTTCACATGGTATGACTGCATAGTGGACTGGAATAGTTTATACGTAAACAACAAATGCCCCACTTGCACTGGCCCAGTTTCTTGTCAAGAACATCAATGCACGAATGTCCGCACATCTTACACTTACGAAAACCCATCATGTATTCCGGTAACCAACACTTCGACTTTACCTGGTTGGGGAGACTGCACGTGCCCGGT...

CDS

Download CDS FASTA

1098 bp · TkA06G374910|TK1151|CDS

ATGGCTGCATGGGTAAACGCACATTTCTTGCATAAAAACTTACTTATAGACATAGACGCACCTTTCACATGGTATGACTGCATAGTGGACTGGAATAGTTTATACGTAAACAACAAATGCCCCACTTGCACTGGCCCAGTTTCTTGTCAAGAACATCAATGCACGAATGTCCGCACATCTTACACTTACGAAAACCCATCATGTATTCCGGTAACCAACACTTCGACTTTACCTGGTTGGGGAGACTGCACGTGCCCGGT...

Protein

Download Protein FASTA

365 aa · TkA06G374910|TK1151|PROTEIN

MAAWVNAHFLHKNLLIDIDAPFTWYDCIVDWNSLYVNNKCPTCTGPVSCQEHQCTNVRTSYTYENPSCIPVTNTSTLPGWGDCTCPVNVVNPINGTCSQALLNYDTFAFNPNAACAPSSTFESFPENVSGVMAFSTSRYAIPAYLFQPFATTFALCLPRSLSTNGVMFFGIGPYYFLPNSNLDLRSFLTYTPLLKHPDSFGYFIGVKTVVVRRRSIDVSNSTTKLSTTAPYTILRTDIYKQVVHMVSVATMGILRARPVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G374910`
TK1151 ID	TkA06G374910
OH-1004 ID	LXL04_023249
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	77.900
Protein coverage (%)	TK1151 100.000 / OH-1004 88.028 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G374910`
Location	Chr06:92815009-92816151 (-)
Description	Similar to GIP2: Probable aspartic proteinase GIP2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023249` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000272 polysaccharide catabolic process Biological Process GO:0006032 chitin catabolic process Biological Process GO:0006508 proteolysis Biological Process GO:0006952 defense response Biological Process GO:0048364 root development Biological Process GO:0048367 shoot system development Biological Process GO:0050832 defense response to fungus Biological Process GO:0005576 extracellular region Cellular Component GO:0048046 apoplast Cellular Component GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0008843 endochitinase activity Molecular Function GO:0019863 IgE binding Molecular Function
KEGG gene cross-reference	dosa:Os01g0937050 gmx:547485 osa:9267890 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.351

Rank 1 · TkA06G374910 · TK1151

Cell membrane0.257

Rank 2 · TkA06G374910 · TK1151

Endoplasmic reticulum0.131

Rank 3 · TkA06G374910 · TK1151

Cytoplasm0.103

Rank 4 · TkA06G374910 · TK1151

Lysosome / Vacuole0.080

Rank 5 · TkA06G374910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N13-170 aa

PF14541TAXi_C202-347 aa

PF14543TAXi_N283-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G374910	`PF14543`	TAXi_N	13	170	2.7e-14	54.5
TkA06G374910	`PF14541`	TAXi_C	202	347	2.2e-36	125.8
TkA06G374910	`PF14543`	TAXi_N	283	305	2.7e-14	54.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card