LXL04_023249 | RubberDandelionOmics

Gene overview

LXL04_023249

Reference: OH-1004 Chr: Chr05 Coordinates: 28556937-28558217 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · LXL04_023249|LXL04_023249|OH1004|cDNA

atgGGACCTCATTTTCAGCTAGTTGTTTTCCTTCTAGCCATCTTCTCCCATGAACCTGAAGCCATAGCACAATACGTACCACCATTCACTTCCAAAGTTGCACAAGTAACCAAACATATCGATGCTGCTACACCTCTTTACAGCATTCAGATGATGACTTCATGGGTAAACGCACACTTCTTGCATGCAAATTTCCTTATAGACATAGACGCTCCTTTCACATGGTCTGACTGCACCGTTGACTGGAAAAGTTTGTACAC...

CDS

Download CDS FASTA

1281 bp · LXL04_023249|LXL04_023249|OH1004|CDS

ATGGGACCTCATTTTCAGCTAGTTGTTTTCCTTCTAGCCATCTTCTCCCATGAACCTGAAGCCATAGCACAATACGTACCACCATTCACTTCCAAAGTTGCACAAGTAACCAAACATATCGATGCTGCTACACCTCTTTACAGCATTCAGATGATGACTTCATGGGTAAACGCACACTTCTTGCATGCAAATTTCCTTATAGACATAGACGCTCCTTTCACATGGTCTGACTGCACCGTTGACTGGAAAAGTTTGTACAC...

Protein

Download Protein FASTA

426 aa · LXL04_023249|LXL04_023249|OH1004|PROTEIN

MGPHFQLVVFLLAIFSHEPEAIAQYVPPFTSKVAQVTKHIDAATPLYSIQMMTSWVNAHFLHANFLIDIDAPFTWSDCTVDWKSLYTNTNCPICTGPVSCQEYQCTDIRSSYSYEGPSCIPVTNTSTLPGWGDCTCPVNIVNPVNGKCGQALVNYDSFTLNASDGRNPFPDFYVNNPNAACAPSSMFESFPANVSGVMAFSTSRYAFPSYIYNPFGNILAICLPSSLSTPGVMFFGIGPYYLLPNSDVDLRSLLSYTPLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023249`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023249

Location Chr05:28556937-28558217 (-)

Description Similar to GIP2: Probable aspartic proteinase GIP2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0937050`	Chitinase that possesses antifungal activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023249 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0006508 proteolysis Biological Process

GO:0006952 defense response Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0008843 endochitinase activity Molecular Function

GO:0019863 IgE binding Molecular Function

KEGG gene cross-reference

dosa:Os01g0937050

gmx:547485

osa:9267890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.316

Rank 1 · LXL04_023249 · OH-1004

Cell membrane0.278

Rank 2 · LXL04_023249 · OH-1004

Endoplasmic reticulum0.137

Rank 3 · LXL04_023249 · OH-1004

Cytoplasm0.101

Rank 4 · LXL04_023249 · OH-1004

Lysosome / Vacuole0.093

Rank 5 · LXL04_023249 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N63-236 aa

PF14541.12TAXi_C268-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023249	`PF14543.12`	TAXi_N	63	236	6.8e-16	59.7
LXL04_023249	`PF14541.12`	TAXi_C	268	408	2.1e-38	132.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S1V1`	Oryza sativa subsp. japonica	Chitinase CLP	31.798%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card