TkA06G255380 | RubberDandelionOmics

Gene overview

TkA06G255380

Reference: TK1151 Chr: Chr06 Coordinates: 65155212-65157366 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · TkA06G255380|TK1151|cDNA

ATGGCTTGGATTGAAGCATTTCACTCGGATCACCTTACAAACACATGGATCAGTTTACAAACACACGAATCACGATCAGCTCCATTTCCTCTCCACAGCCTCGATCCGGTTGCACAGCCTCGATCAGCTCCATTTCCTCTCCACGCTTGCACGCTTCCTCCGATTCCATTTCAAATGGCGCCAAATTTGATCGATTTCCTCTGCACGCTGCCTCGAAACTTGATGGATTTCCCTATCTATATTTACCCATTTGAAGATCG...

CDS

Download CDS FASTA

1140 bp · TkA06G255380|TK1151|CDS

ATGGCTTGGATTGAAGCATTTCACTCGGATCACCTTACAAACACATGGATCAGTTTACAAACACACGAATCACGATCAGCTCCATTTCCTCTCCACAGCCTCGATCCGGTTGCACAGCCTCGATCAGCTCCATTTCCTCTCCACGCTTGCACGCTTCCTCCGATTCCATTTCAAATGGCGCCAAATTTGATCGATTTCCTCTGCACGCTGCCTCGAAACTTGATGGATTTCCCTATCTATATTTACCCATTTGAAGATCG...

Protein

Download Protein FASTA

379 aa · TkA06G255380|TK1151|PROTEIN

MAWIEAFHSDHLTNTWISLQTHESRSAPFPLHSLDPVAQPRSAPFPLHACTLPPIPFQMAPNLIDFLCTLPRNLMDFPIYIYPFEDRGCREIIFRACGITNRSRVYRNQLSIWFVLQLDRFPLHEFPYSAPVSNLIDSLFGVAALRNQLSIWFVLQLDRFPLHEFPYSAPVRQVKTAAFFQLAYDSASVGSDEFVLVFQNCERDGRNSQEEEDSIVLQADLISSIDEVRQVKTAAFCRKQTSSVEKNRYPAGTLEAPLTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G255380`
TK1151 ID	TkA06G255380
OH-1004 ID	LXL04_034702
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.200
Protein coverage (%)	TK1151 37.995 / OH-1004 10.403 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G255380

Location Chr06:65155212-65157366 (+)

Description Similar to PLA1: Phospholipase A I

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61850`	Possesses non-specific lipolytic acyl hydrolase (LAH) activity.	AtPLAI is an acyl hydrolase involved in basal jasmonic acid production and Arabidopsis resistance to Botrytis cinerea.2007 · DOI: 10.1074/jbc.m700405200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034702 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009620 response to fungus Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019369 arachidonate metabolic process Biological Process

GO:0032048 cardiolipin metabolic process Biological Process

GO:0034638 phosphatidylcholine catabolic process Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043651 linoleic acid metabolic process Biological Process

GO:0046338 phosphatidylethanolamine catabolic process Biological Process

GO:0050482 arachidonate secretion Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

hsa:50640

mmu:67452

ocu:100328577

rno:314075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.507

Rank 1 · TkA06G255380 · TK1151

Nucleus0.348

Rank 2 · TkA06G255380 · TK1151

Mitochondrion0.127

Rank 3 · TkA06G255380 · TK1151

Cell membrane0.103

Rank 4 · TkA06G255380 · TK1151

Endoplasmic reticulum0.087

Rank 5 · TkA06G255380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01734Patatin290-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G255380	`PF01734`	Patatin	290	334	0.00015	22.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HX15`	Arabidopsis thaliana	sp\|F4HX15\|LPAI_ARATH Phospholipase A I	50.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card