TkA06G241530 | RubberDandelionOmics

Gene overview

TkA06G241530

Reference: TK1151 Chr: Chr06 Coordinates: 61829259-61834817 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · TkA06G241530|TK1151|cDNA

AAGAGTCTTTCTGAGATTTCTGATGTGGGGTGTGCGAGAAAAGTCTGGCAGTGCCTAAGAAGCTTCGATGGAGTGGAAGATGTGACGACGGATTGTAAGACGCATAAAGTTGTAGTGAAGGGAGAAAAAGCAGATCCGTTGAAGGTTCTTGAAAGAGTCCAGAAAAAGAGTCACCGGCAAGTTGAGCTCCTTTCTCCGATACCAAAACCGTCTGCGGAGGAGCCTAAAGTCGAAGAGAAAGAATCTCCGAAACCAGAAGC...

CDS

Download CDS FASTA

1236 bp · TkA06G241530|TK1151|CDS

AAGAGTCTTTCTGAGATTTCTGATGTGGGGTGTGCGAGAAAAGTCTGGCAGTGCCTAAGAAGCTTCGATGGAGTGGAAGATGTGACGACGGATTGTAAGACGCATAAAGTTGTAGTGAAGGGAGAAAAAGCAGATCCGTTGAAGGTTCTTGAAAGAGTCCAGAAAAAGAGTCACCGGCAAGTTGAGCTCCTTTCTCCGATACCAAAACCGTCTGCGGAGGAGCCTAAAGTCGAAGAGAAAGAATCTCCGAAACCAGAAGC...

Protein

Download Protein FASTA

411 aa · TkA06G241530|TK1151|PROTEIN

KSLSEISDVGCARKVWQCLRSFDGVEDVTTDCKTHKVVVKGEKADPLKVLERVQKKSHRQVELLSPIPKPSAEEPKVEEKESPKPEAKKVEPPQVIIVILKVNMHCEACAQEIRKRILRIWNKTNWTLDIKRGNPRLVKDGICHVYVDKAANLEMAKKIVLDAKTDYPAACNAMETLLVHKDLTKGGLQDLVKELEQEDEAIKHIHNYGSSLTECIITDDQEVAEYFLSRVDSAAVFHNASTRFCDGARFGLGAEVGINT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G241530`
TK1151 ID	TkA06G241530
OH-1004 ID	LXL04_011846
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.900
Protein coverage (%)	TK1151 87.348 / OH-1004 84.475 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G241530

Location Chr06:61829259-61834817 (-)

Description Similar to P5CS: Delta-1-pyrroline-5-carboxylate synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55610`	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0455500`	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.	No verified direct reference in this release
`Os01g0848200`	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011846 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0055129 L-proline biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004349 glutamate 5-kinase activity Molecular Function

GO:0004350 glutamate-5-semialdehyde dehydrogenase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G55610

dosa:Os01g0848200

dosa:Os05g0455500

osa:4338979

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.416

Rank 1 · TkA06G241530 · TK1151

Nucleus0.336

Rank 2 · TkA06G241530 · TK1151

Cell membrane0.223

Rank 3 · TkA06G241530 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkA06G241530 · TK1151

Mitochondrion0.082

Rank 5 · TkA06G241530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403HMA5-55 aa

PF10656DUF248320-53 aa

PF00403HMA101-119 aa

PF00171Aldedh145-196 aa

PF00171Aldedh192-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G241530	`PF00403`	HMA	5	55	2.5e-11	44.5
TkA06G241530	`PF10656`	DUF2483	20	53	0.11	13.6
TkA06G241530	`PF00403`	HMA	101	119	2.5e-11	44.5
TkA06G241530	`PF00171`	Aldedh	145	196	0.025	13.9
TkA06G241530	`PF00171`	Aldedh	192	250	0.025	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P54888`	Arabidopsis thaliana	sp\|P54888\|P5CS2_ARATH Delta-1-pyrroline-5-carboxylate synthase B	60.500%	Swiss-Prot	Low
`O04226`	Oryza sativa subsp. japonica	sp\|O04226\|P5CS1_ORYSJ Delta-1-pyrroline-5-carboxylate synthase 1	60.500%	Swiss-Prot	Low
`Q941T1`	Oryza sativa subsp. japonica	sp\|Q941T1\|P5CS2_ORYSJ Delta-1-pyrroline-5-carboxylate synthase 2	60.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card