LXL04_011846 | RubberDandelionOmics

Gene overview

LXL04_011846

Reference: OH-1004 Chr: Chr03 Coordinates: 1389854-1392946 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · LXL04_011846|LXL04_011846|OH1004|cDNA

ATGAGAGAGTTCATAGGAATTTGTTTAACAGATGGGTCCCCTGTGAAGAGTCTTTCTGAGATTTTTGATGTGGGATGTGCGAGAAAAGTCTGGCAGTGCCTAAGAGGCTTCGATGGAGTGGAAGATGTGACGACGGATTGTAAGACGCATAAAATTGTAGTGAAGGGAGAAAAAGCAGATCCGTTGAAGGTTCTTGAAAGAGTCCAAAAAAAGAGTCACCGGCAAGTTGAGCTCCTTTCTCCGATACCAAAACCGTCTGC...

CDS

Download CDS FASTA

1317 bp · LXL04_011846|LXL04_011846|OH1004|CDS

ATGAGAGAGTTCATAGGAATTTGTTTAACAGATGGGTCCCCTGTGAAGAGTCTTTCTGAGATTTTTGATGTGGGATGTGCGAGAAAAGTCTGGCAGTGCCTAAGAGGCTTCGATGGAGTGGAAGATGTGACGACGGATTGTAAGACGCATAAAATTGTAGTGAAGGGAGAAAAAGCAGATCCGTTGAAGGTTCTTGAAAGAGTCCAAAAAAAGAGTCACCGGCAAGTTGAGCTCCTTTCTCCGATACCAAAACCGTCTGC...

Protein

Download Protein FASTA

438 aa · LXL04_011846|LXL04_011846|OH1004|PROTEIN

MREFIGICLTDGSPVKSLSEIFDVGCARKVWQCLRGFDGVEDVTTDCKTHKIVVKGEKADPLKVLERVQKKSHRQVELLSPIPKPSAEEPKVEEKESPKPEEKKVEPPQVITVILKVNMHCEACAQEIRKRILRMKGDHFCRSGNSWNKTNWTLDIKRGNPRLVKDGICHVYVDKVANLEMAKKIVLDAKTDYPAACNAMETLLVHKDLTKGGLQDLVKELEQEDDAIEHIHIYGSSHTECIITDDQEVAEYFLSRVDSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011846`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011846

Location Chr03:1389854-1392946 (-)

Description Similar to P5CS: Delta-1-pyrroline-5-carboxylate synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55610`	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0455500`	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.	No verified direct reference in this release
`Os01g0848200`	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011846 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0055129 L-proline biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004349 glutamate 5-kinase activity Molecular Function

GO:0004350 glutamate-5-semialdehyde dehydrogenase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G55610

dosa:Os01g0848200

dosa:Os05g0455500

osa:4338979

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.395

Rank 1 · LXL04_011846 · OH-1004

Nucleus0.335

Rank 2 · LXL04_011846 · OH-1004

Cell membrane0.210

Rank 3 · LXL04_011846 · OH-1004

Endoplasmic reticulum0.113

Rank 4 · LXL04_011846 · OH-1004

Mitochondrion0.104

Rank 5 · LXL04_011846 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403.33HMA21-70 aa

PF00403.33HMA116-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011846	`PF00403.33`	HMA	21	70	6.9e-12	46.3
LXL04_011846	`PF00403.33`	HMA	116	139	6.9e-12	46.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P54888`	Arabidopsis thaliana	Delta-1-pyrroline-5-carboxylate synthase B	61.000%	Swiss-Prot	weak database homology
`O04226`	Oryza sativa subsp. japonica	Delta-1-pyrroline-5-carboxylate synthase 1	62.000%	Swiss-Prot	weak database homology
`Q941T1`	Oryza sativa subsp. japonica	Delta-1-pyrroline-5-carboxylate synthase 2	62.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card