TkA06G193330 | RubberDandelionOmics

Gene overview

TkA06G193330

Reference: TK1151 Chr: Chr06 Coordinates: 50350325-50352603 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1393 bp · TkA06G193330|TK1151|cDNA

AAAGGGAAAGCGTACTACGCATGAAGGCATTAAATCCGGGTTCCTAAAACCTCCTTCTACCATAATTTTCTACTGTCAAAATACTTCTAGCAGCTTCAATGGGTGTCATACGAACAGACGAGCTTCGGAGAGCTGAGATCGAAGAGTTCCGCCGCATGCTCTTGTCCTGCTCCGGCGTTGTCCTCAAGGTTAGAAACGAAGAGGAGTACAACCGCCGGCGGGTGCCAGAAGCTAACAGAAACGAATATACAGTAGATCAG...

CDS

Download CDS FASTA

1098 bp · TkA06G193330|TK1151|CDS

ATGGGTGTCATACGAACAGACGAGCTTCGGAGAGCTGAGATCGAAGAGTTCCGCCGCATGCTCTTGTCCTGCTCCGGCGTTGTCCTCAAGGTTAGAAACGAAGAGGAGTACAACCGCCGGCGGGTGCCAGAAGCTAACAGAAACGAATATACAGTAGATCAGAAGCTTGTATGCGTCACAAGCGGCGTCTCTTTACTTGGTGTCGCTCTTGTGAAAAAACTCTTACTCAGAGGCTATTCCGCTCGAATCGTCGTCAACAA...

Protein

Download Protein FASTA

365 aa · TkA06G193330|TK1151|PROTEIN

MGVIRTDELRRAEIEEFRRMLLSCSGVVLKVRNEEEYNRRRVPEANRNEYTVDQKLVCVTSGVSLLGVALVKKLLLRGYSARIVVNNEEDVERLREMEITEEIGGASNITSNSTIGVVVAKLNERQSLMDAFDGCCAVFHTAAFIDPTGVSGYSKCMAEIEAKAAENIAEACAATSSVRNYVLTSSLLTCIWRDISDSNLSPVVDHDTWSDESFCNRKKLWYALGKLKAERVSYEIAKEKGLKLATICSGLTTGPRYFCT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G193330`
TK1151 ID	TkA06G193330
OH-1004 ID	LXL04_023974
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G193330

Location Chr06:50350325-50352603 (+)

Description Similar to SNL6: Cinnamoyl-CoA reductase-like SNL6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0639200`	Involved in defense response.	Rice Snl6, a cinnamoyl-CoA reductase-like gene family member, is required for NH1-mediated immunity to Xanthomonas oryzae pv. oryzae.2010 · DOI: 10.1371/journal.pgen.1001123

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023974 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006694 steroid biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048316 seed development Biological Process

GO:0080110 sporopollenin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G15950

ath:AT4G35420

dosa:Os01g0639200

dosa:Os02g0808800

osa:4326581

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.489

Rank 1 · TkA06G193330 · TK1151

Nucleus0.438

Rank 2 · TkA06G193330 · TK1151

Cell membrane0.077

Rank 3 · TkA06G193330 · TK1151

Plastid0.064

Rank 4 · TkA06G193330 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA06G193330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14517Tachylectin15-62 aa

PF05368NmrA54-183 aa

PF02719Polysacc_synt_257-185 aa

PF01370Epimerase58-268 aa

PF010733Beta_HSD59-187 aa

PF13460NAD_binding_1067-188 aa

PF04321RmlD_sub_bind122-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G193330	`PF14517`	Tachylectin	15	62	0.2	12.1
TkA06G193330	`PF05368`	NmrA	54	183	0.017	15.4
TkA06G193330	`PF02719`	Polysacc_synt_2	57	185	0.0017	18.4
TkA06G193330	`PF01370`	Epimerase	58	268	3.3e-07	30.7
TkA06G193330	`PF01073`	3Beta_HSD	59	187	1.2e-06	28.5
TkA06G193330	`PF13460`	NAD_binding_10	67	188	2.4e-05	25.0
TkA06G193330	`PF04321`	RmlD_sub_bind	122	176	0.15	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0JKZ0`	Oryza sativa subsp. japonica	sp\|Q0JKZ0\|SNL6_ORYSJ Cinnamoyl-CoA reductase-like SNL6	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card