TkA06G190330 | RubberDandelionOmics

Gene overview

TkA06G190330

Reference: TK1151 Chr: Chr06 Coordinates: 49639852-49646368 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2950 bp · TkA06G190330|TK1151|cDNA

CCACCGCCCACAACTATCCAACTACACAAAACATTTGTATTCTAGCACTCGGATCTTTAATATGCTTTAAATTTCTAGTACAAGCACAAGTGGAGCTCTCTCCTTCCTCCTCTAACCATTTGAGCACAAAGAACCAGACGACGCTGCCACGCACACCCTTTTTATCTTTCATGCTTTAACACAGCACCTAATTCTCACCACCCACAACTCCATCACAACCACTTCTCATTTTCCTCACGTTTTCTCTCTATCGTTTCTAT...

CDS

Download CDS FASTA

2355 bp · TkA06G190330|TK1151|CDS

ATGGATATTGAGGCCCCAAATCGAAATTCTCATCCAATTAAGAAGGAATCATGGAGGACTGTGATGACTTTGGCTTATCAAAGTTTGGGTGTTGTTTATGGCGATTTAAGCACCTCTCCTTTGTATGTTTACAAAAGTGCGTTTGCGGAAGACATTCAACATTCGGAATCAAATGAAGAAATATTTGGGGTTTTATCTTTCGTGTTCTGGACACTGACTTTAATCCCGCTTCTAAAATACGTTTTCATAGTGCTTCGAGC...

Protein

Download Protein FASTA

784 aa · TkA06G190330|TK1151|PROTEIN

MDIEAPNRNSHPIKKESWRTVMTLAYQSLGVVYGDLSTSPLYVYKSAFAEDIQHSESNEEIFGVLSFVFWTLTLIPLLKYVFIVLRADDNGEGGTFALYTLLCRHARVSTLPNGQLADEELYEYRKDEISSGSRDIGLSLKSTLEKHKILQKVLLVLALLGTCMVIGDGVLTPAISVFSAVSGLELSMSKEHHQYVEVPVACIILVLLFFLQHYGTHRVGFLFAPIVITWLLCISTIGVYNIFHWNPQVFQALSPYYMYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G190330`
TK1151 ID	TkA06G190330
OH-1004 ID	LXL04_023995
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G190330

Location Chr06:49639852-49646368 (-)

Description Similar to POT8: Potassium transporter 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14880`	Probable potassium transporter.	No verified direct reference in this release
`At1g70300`	Probable potassium transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0625900`	High-affinity potassium transporter.	Inventory and functional characterization of the HAK potassium transporters of rice.2002 · DOI: 10.1104/pp.007781
`Os02g0730300`	High-affinity potassium transporter.	No verified direct reference in this release
`Os06g0270200`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023995 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G70300

ath:AT2G40540

ath:AT5G14880

dosa:Os02g0730300

dosa:Os06g0625900

osa:4330614

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.542

Rank 1 · TkA06G190330 · TK1151

Lysosome / Vacuole0.254

Rank 2 · TkA06G190330 · TK1151

Cytoplasm0.133

Rank 3 · TkA06G190330 · TK1151

Endoplasmic reticulum0.091

Rank 4 · TkA06G190330 · TK1151

Golgi apparatus0.078

Rank 5 · TkA06G190330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705K_trans23-503 aa

PF19589DUF6095148-175 aa

PF19589DUF6095345-358 aa

PF19589DUF6095384-425 aa

PF19589DUF6095456-466 aa

PF22776K_trans_C534-783 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G190330	`PF02705`	K_trans	23	503	1.5e-163	545.3
TkA06G190330	`PF19589`	DUF6095	148	175	2.4	9.1
TkA06G190330	`PF19589`	DUF6095	345	358	2.4	9.1
TkA06G190330	`PF19589`	DUF6095	384	425	2.4	9.1
TkA06G190330	`PF19589`	DUF6095	456	466	2.4	9.1
TkA06G190330	`PF22776`	K_trans_C	534	783	2.2e-25	90.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7J9`	Arabidopsis thaliana	sp\|Q9M7J9\|POT8_ARATH Potassium transporter 8	75.300%	Swiss-Prot	High
`Q8W4I4`	Arabidopsis thaliana	sp\|Q8W4I4\|POT6_ARATH Potassium transporter 6	71.700%	Swiss-Prot	High
`Q67VS5`	Oryza sativa subsp. japonica	sp\|Q67VS5\|HAK10_ORYSJ Potassium transporter 10	67.800%	Swiss-Prot	High
`Q6YWQ4`	Oryza sativa subsp. japonica	sp\|Q6YWQ4\|HAK25_ORYSJ Potassium transporter 25	69.100%	Swiss-Prot	High
`Q5Z6K9`	Oryza sativa subsp. japonica	sp\|Q5Z6K9\|HAK24_ORYSJ Potassium transporter 24	67.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card