LXL04_023995 | RubberDandelionOmics

Gene overview

LXL04_023995

Reference: OH-1004 Chr: Chr05 Coordinates: 77086468-77092392 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2352 bp · LXL04_023995|LXL04_023995|OH1004|cDNA

ATGGATATTGAGGCCCCAAATCGAAATTCTCATCCAATTAAGAAGGAATCATGGAGGGCTGTGATGACTTTGGCTTATCAAAGTTTGGGTGTTGTTTATGGCGATTTAAGCACCTCTCCTTTGTATGTTTACAAAAGTGCGTTTGCGGAAGACATTCAACATTCGGAATCAAATGAAGAAATATTTGGGGTTTTATCTTTCGTGTTCTGGACACTGACTTTAATCCCGCTTCTAAAATACGTTTTCATAGTGCTTCGAGC...

CDS

Download CDS FASTA

2352 bp · LXL04_023995|LXL04_023995|OH1004|CDS

ATGGATATTGAGGCCCCAAATCGAAATTCTCATCCAATTAAGAAGGAATCATGGAGGGCTGTGATGACTTTGGCTTATCAAAGTTTGGGTGTTGTTTATGGCGATTTAAGCACCTCTCCTTTGTATGTTTACAAAAGTGCGTTTGCGGAAGACATTCAACATTCGGAATCAAATGAAGAAATATTTGGGGTTTTATCTTTCGTGTTCTGGACACTGACTTTAATCCCGCTTCTAAAATACGTTTTCATAGTGCTTCGAGC...

Protein

Download Protein FASTA

783 aa · LXL04_023995|LXL04_023995|OH1004|PROTEIN

MDIEAPNRNSHPIKKESWRAVMTLAYQSLGVVYGDLSTSPLYVYKSAFAEDIQHSESNEEIFGVLSFVFWTLTLIPLLKYVFIVLRADDNGEGGTFALYTLLCRHARVSTLPNGQLADEELYEYRKDEISSGSRDIGLSLKSTLEKHKILQKVLLVLALLGTCMVIGDGVLTPAISVFSAVSGLELSMSKEHHQYVEVPVACIILVLLFFLQHYGTHRVGFLFAPIVITWLLCISTIGVYNIFHWNPQVFQALSPYYMYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023995`
TK1151 ID	TkA06G190330
OH-1004 ID	LXL04_023995
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023995

Location Chr05:77086468-77092392 (+)

Description Similar to POT8: Potassium transporter 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14880`	Probable potassium transporter.	No verified direct reference in this release
`At1g70300`	Probable potassium transporter.	No verified direct reference in this release
`At2g40540`	Low-affinity potassium transporter.	A mutation in the Arabidopsis KT2/KUP2 potassium transporter gene affects shoot cell expansion.2002 · DOI: 10.1105/tpc.010322

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0625900`	High-affinity potassium transporter.	Inventory and functional characterization of the HAK potassium transporters of rice.2002 · DOI: 10.1104/pp.007781
`Os02g0730300`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023995 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G70300

ath:AT2G40540

ath:AT5G14880

dosa:Os02g0730300

dosa:Os06g0625900

osa:4330614

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.555

Rank 1 · LXL04_023995 · OH-1004

Lysosome / Vacuole0.241

Rank 2 · LXL04_023995 · OH-1004

Cytoplasm0.135

Rank 3 · LXL04_023995 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_023995 · OH-1004

Golgi apparatus0.077

Rank 5 · LXL04_023995 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705.23K_trans23-503 aa

PF22776.1K_trans_C534-782 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023995	`PF02705.23`	K_trans	23	503	1.5e-163	545.3
LXL04_023995	`PF22776.1`	K_trans_C	534	782	1.5e-25	90.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7J9`	Arabidopsis thaliana	Potassium transporter 8	75.810%	Swiss-Prot	strong database homology
`Q8W4I4`	Arabidopsis thaliana	Potassium transporter 6	71.859%	Swiss-Prot	strong database homology
`O22881`	Arabidopsis thaliana	Potassium transporter 2	65.057%	Swiss-Prot	strong database homology
`Q67VS5`	Oryza sativa subsp. japonica	Potassium transporter 10	67.182%	Swiss-Prot	strong database homology
`Q6YWQ4`	Oryza sativa subsp. japonica	Potassium transporter 25	70.347%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card