RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G187660
Reference: TK1151 Chr: Chr06 Coordinates: 48981032-48984910 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2662 bp · TkA06G187660|TK1151|cDNA

AAAACACCGAGTTGACCAAAATTTGATGCCATCTTCGTCTGTCACATCTTTCTTATACTATTATTAATACACACTTCCACGATTAAGCTCGCAGGCCTCACTAACCCTTCAATTCCTCTCTCAGAAAACGAATTTCTCTTTTCCAAATTCCTCTTCCAAGATCCAATTCATCACGCGAAGCTTCATTAATGAGTTCCCAATTTCCTTAGCCCTAAACCCCTTTTCGACTTTTCATTTCTTGGGGTTCTGATCAATTTTGG...

CDS

Download CDS FASTA

1614 bp · TkA06G187660|TK1151|CDS

ATGGGACTGTTTCATTGGTCTTACATGGGTTGGGTATCATTCAGAGCTGATTATATTGCTCCATCGATCATGATGTTATCGCAATTCTGTGTTGTTCTTTTCATGATTCAATCGCTTGATCGATTTATACTAGGAATGGGATGTTTTTGGATCAAGTTCAGGAACATAAAACCGACAATTGATGGCGACGCTTATGACATTGAAGATGCTTCCAGTTTCCCCATGGTCCTTGTTCAGATCCCCATGTGCAATGAAAGAGA...

Protein

Download Protein FASTA

537 aa · TkA06G187660|TK1151|PROTEIN

MGLFHWSYMGWVSFRADYIAPSIMMLSQFCVVLFMIQSLDRFILGMGCFWIKFRNIKPTIDGDAYDIEDASSFPMVLVQIPMCNEREVYQQSIASACQLDWPKDRILIQVLDDSSDELLQMLIRNEVNLWSQKGVNIIYRHRFIRTGYKAGNLHSAMSCDYVKNYEFVAILDADFQPNPDFLQLTVPHFQGKPDVGLVQARWSFVNKDENLLTRLQNINLCFHFEVEQQVNSHFLSFFGFNGTAGVWRIKALEESGGWLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G187660
TK1151 IDTkA06G187660
OH-1004 IDLXL04_006169
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)90.700
Protein coverage (%)TK1151 99.814 / OH-1004 80.514
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G187660
LocationChr06:48981032-48984910 (+)
DescriptionSimilar to CSLC4: Xyloglucan glycosyltransferase 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g28180 Beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.
A gene from the cellulose synthase-like C family encodes a beta-1,4 glucan synthase.2007 · DOI: 10.1073/pnas.0703133104
Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
At2g24630 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. No verified direct reference in this release
At4g31590 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0428000 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. No verified direct reference in this release
UniProt: Q7PC70 Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006169 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0048868 pollen tube development Biological Process
GO:0071555 cell wall organization Biological Process
GO:0099402 plant organ development Biological Process
GO:0000138 Golgi trans cisterna Cellular Component
GO:0000139 Golgi membrane Cellular Component
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0016757 glycosyltransferase activity Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference
ath:AT2G24630
ath:AT3G28180
ath:AT4G31590
dosa:Os09g0428000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.466
Rank 1 · TkA06G187660 · TK1151
Golgi apparatus0.272
Rank 2 · TkA06G187660 · TK1151
Cell membrane0.128
Rank 3 · TkA06G187660 · TK1151
Cytoplasm0.115
Rank 4 · TkA06G187660 · TK1151
Nucleus0.108
Rank 5 · TkA06G187660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03142Chitin_synth_258-113 aa
PF13506Glyco_transf_2173-326 aa
PF13641Glyco_tranf_2_374-307 aa
PF00535Glycos_transf_279-226 aa
PF03142Chitin_synth_2161-257 aa
PF13632Glyco_trans_2_3168-362 aa
PF03142Chitin_synth_2278-433 aa
PF20967MASE7404-428 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G187660PF03142Chitin_synth_2581130.001118.5
TkA06G187660PF13506Glyco_transf_21733262e-1247.4
TkA06G187660PF13641Glyco_tranf_2_3743071e-1352.3
TkA06G187660PF00535Glycos_transf_2792269.2e-1142.7
TkA06G187660PF03142Chitin_synth_21612570.001118.5
TkA06G187660PF13632Glyco_trans_2_31683629.2e-2381.8
TkA06G187660PF03142Chitin_synth_22784330.001118.5
TkA06G187660PF20967MASE74044281.49.3
TkA06G187660PF20967MASE74935311.49.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LJP4Arabidopsis thalianasp|Q9LJP4|CSLC4_ARATH Xyloglucan glycosyltransferase 477.800%Swiss-ProtHigh
Q9SJA2Arabidopsis thalianasp|Q9SJA2|CSLC8_ARATH Probable xyloglucan glycosyltransferase 877.200%Swiss-ProtHigh
Q9SB75Arabidopsis thalianasp|Q9SB75|CSLC5_ARATH Probable xyloglucan glycosyltransferase 576.000%Swiss-ProtHigh
Q69L19Oryza sativa subsp. japonicasp|Q69L19|CSLC2_ORYSJ Probable xyloglucan glycosyltransferase 275.600%Swiss-ProtHigh
Q7PC70Oryza sativa subsp. indicasp|Q7PC70|CSLC2_ORYSI Probable xyloglucan glycosyltransferase 275.400%Swiss-ProtHigh

JBrowse

View in Genome Browser